BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20177 (609 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1144 + 31222556-31222633,31223238-31227665,31227724-312277... 31 0.94 01_06_0481 - 29646245-29646371,29646474-29646556,29646672-296467... 31 0.94 12_02_1286 - 27555143-27555191,27555290-27555511,27555911-275561... 29 2.2 09_02_0570 + 10786779-10787144,10787353-10787547,10787647-107878... 28 6.7 05_01_0547 - 4774320-4776089,4776823-4777028,4777563-4777818 27 8.8 03_05_1143 + 30709825-30709926,30710105-30710260,30710356-307104... 27 8.8 02_04_0058 - 19329380-19330498,19330941-19330988,19331797-19332174 27 8.8 >04_04_1144 + 31222556-31222633,31223238-31227665,31227724-31227789, 31227790-31228014,31228097-31228255,31228393-31228551, 31228855-31229013,31229371-31229490,31229604-31229825 Length = 1871 Score = 30.7 bits (66), Expect = 0.94 Identities = 21/88 (23%), Positives = 46/88 (52%), Gaps = 3/88 (3%) Frame = +3 Query: 219 SNRRQTGET*VQEKMLGEQVKKMLMALDKKHRMLEPLKGMISRLDQRLSNVETILLQKEE 398 + +QT E ++++ EQ+ + LD+ E L+G I+ L+ +L+ +++L Q E+ Sbjct: 348 AKEKQTWEATLEKQQ--EQILNLQTELDESKGGNETLRGTIADLNSKLAERDSLLRQAED 405 Query: 399 REKGSXKKTDEAL---ESIQKSIPSSND 473 + EAL + ++ ++ S N+ Sbjct: 406 EHAKAQLLLSEALSHKDELEVNLKSINE 433 >01_06_0481 - 29646245-29646371,29646474-29646556,29646672-29646752, 29646843-29646899,29647007-29647094,29647304-29647374, 29647457-29647585,29647662-29648051,29648332-29648517, 29648612-29648692,29648787-29648879,29648966-29649086, 29649200-29649409,29649560-29649727,29649898-29650065, 29650144-29650311,29650453-29650620,29650738-29650905, 29651023-29651190,29651567-29651734,29652391-29652558, 29652645-29652812,29655720-29655887,29656069-29656236, 29656391-29656558,29656670-29656837,29657525-29657664, 29658033-29658221,29658243-29658315,29658379-29658452, 29658535-29658654,29658718-29658738,29658794-29658999, 29659094-29659271,29660066-29660126,29660232-29660341, 29660427-29660558,29661091-29661258,29661339-29661465, 29661794-29661831,29663321-29663422,29663505-29663562, 29663659-29663760,29663844-29663990,29664098-29664234, 29664313-29664462,29664561-29664720,29665820-29665878, 29666025-29666181,29666288-29666433,29666523-29666666, 29667242-29667376 Length = 2344 Score = 30.7 bits (66), Expect = 0.94 Identities = 18/76 (23%), Positives = 39/76 (51%), Gaps = 3/76 (3%) Frame = +3 Query: 258 KMLGE---QVKKMLMALDKKHRMLEPLKGMISRLDQRLSNVETILLQKEEREKGSXKKTD 428 K+L E ++ +++ L+ R + L+ I RL++ E +LL +++ + + Sbjct: 1517 KLLAEAHLEIDELIRKLEDSDRKSDSLQSTIKRLEEDGIAKEALLLTEKQAHEATRMTLT 1576 Query: 429 EALESIQKSIPSSNDD 476 EALE ++ + +DD Sbjct: 1577 EALEKNEELLKKIHDD 1592 >12_02_1286 - 27555143-27555191,27555290-27555511,27555911-27556162, 27556683-27557062,27557202-27557311,27557864-27558033, 27558236-27558444,27558528-27558617,27559125-27559264, 27559356-27559463,27559626-27559716,27560736-27560852, 27561497-27561767,27561892-27562193,27562400-27562469, 27563464-27563702,27564613-27564846,27564943-27565179, 27565276-27565734 Length = 1249 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/63 (28%), Positives = 34/63 (53%) Frame = +3 Query: 270 EQVKKMLMALDKKHRMLEPLKGMISRLDQRLSNVETILLQKEEREKGSXKKTDEALESIQ 449 + + K + LDKK L LK ISRL ++ + ++ +++K KK E ++S+Q Sbjct: 298 KSIAKKKLELDKKQPELLRLKEQISRLKSKIKSCN----KEIDKKKDDSKKHLEEMKSLQ 353 Query: 450 KSI 458 ++ Sbjct: 354 SAL 356 >09_02_0570 + 10786779-10787144,10787353-10787547,10787647-10787826, 10787925-10788119,10789629-10789727,10789822-10790328, 10790438-10790779 Length = 627 Score = 27.9 bits (59), Expect = 6.7 Identities = 17/77 (22%), Positives = 38/77 (49%) Frame = +3 Query: 216 ASNRRQTGET*VQEKMLGEQVKKMLMALDKKHRMLEPLKGMISRLDQRLSNVETILLQKE 395 ++NR Q +T V+ + +QVK + +D + + ++ I L+ L ++ + + Sbjct: 226 SANRAQIQDTVVERDAIQDQVKIIGEGIDGVKKERQAVRSKIKVLEDELKAIDMEMGSLQ 285 Query: 396 EREKGSXKKTDEALESI 446 E + + D+A ES+ Sbjct: 286 EDLTAANARKDKAHESL 302 >05_01_0547 - 4774320-4776089,4776823-4777028,4777563-4777818 Length = 743 Score = 27.5 bits (58), Expect = 8.8 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 3/91 (3%) Frame = +3 Query: 303 KKHRMLEPLKGMISRLDQRLSNVETILLQKEE--REKGSXKKTDEALESIQKSIPSSNDD 476 K+ RM + + S LDQ T+ EE REK ++ + + ++ SI + DD Sbjct: 186 KQARMFQEKEA--SLLDQLTLTKRTVTSLNEEVRREKELVEQLKQEIHRLKSSIAQAEDD 243 Query: 477 SH-RECQGK*K*EVGX*LESYXNTLERRLNA 566 H E + + K E L+ N L + +NA Sbjct: 244 KHVFEGKLREKLEALDSLQDKVNLLSQEVNA 274 >03_05_1143 + 30709825-30709926,30710105-30710260,30710356-30710439, 30710769-30710882,30711019-30711111,30711888-30711977, 30712157-30712227,30712300-30712374,30712481-30712568, 30712748-30712806,30712893-30712956,30713030-30713095, 30713283-30713435,30713522-30713626,30713739-30713974, 30714104-30714173,30714286-30714339,30714501-30714557, 30714662-30714741,30716056-30717919 Length = 1226 Score = 27.5 bits (58), Expect = 8.8 Identities = 27/104 (25%), Positives = 45/104 (43%), Gaps = 11/104 (10%) Frame = +3 Query: 216 ASNRRQTGET*VQEKMLGEQVKKMLMALDKKHRMLEPLKGMISRLDQ---------RLSN 368 AS + + ET ++ K+ G +VK L + + + + E + I +D Sbjct: 985 ASTKARESETALRSKIDGLKVK--LRSFEAQRKEAERVLFAIDNIDTSTPTLSKPVNFGK 1042 Query: 369 VETILLQKEEREK--GSXKKTDEALESIQKSIPSSNDDSHRECQ 494 +L +EER K KK+ E L +QK I S N +C+ Sbjct: 1043 ASELLRSEEERTKLLSELKKSREQLIMVQKEIKSMNRHDDIDCK 1086 >02_04_0058 - 19329380-19330498,19330941-19330988,19331797-19332174 Length = 514 Score = 27.5 bits (58), Expect = 8.8 Identities = 31/132 (23%), Positives = 54/132 (40%), Gaps = 1/132 (0%) Frame = +3 Query: 87 RHAERNQTMVGRRRASIVDSSNRMPGSYNRGYPGCADDLSSFGASNRRQTGE-T*VQEKM 263 RH++ + RRR+S S PGS G G +L++ E T ++++ Sbjct: 161 RHSKHLLKKIVRRRSSPTQQSGLQPGS--SGESGLDPELNTLRREKSALLQEVTRLKQEH 218 Query: 264 LGEQVKKMLMALDKKHRMLEPLKGMISRLDQRLSNVETILLQKEEREKGSXKKTDEALES 443 L + +++M + + K M+S L + L N + K R++ T Sbjct: 219 L-QTIEQMSTLNQRLESAEDRQKQMVSFLAKLLQNPTFLRQLKMHRQQKEIDST-RVKRK 276 Query: 444 IQKSIPSSNDDS 479 K +P N DS Sbjct: 277 FLKHVPHGNIDS 288 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,961,485 Number of Sequences: 37544 Number of extensions: 240277 Number of successful extensions: 578 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -