BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20177 (609 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ416109-1|CAC94781.1| 234|Anopheles gambiae PROSAg25 protein p... 27 0.47 AY748836-1|AAV28184.1| 89|Anopheles gambiae cytochrome P450 pr... 23 7.7 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 7.7 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 7.7 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 7.7 >AJ416109-1|CAC94781.1| 234|Anopheles gambiae PROSAg25 protein protein. Length = 234 Score = 27.1 bits (57), Expect = 0.47 Identities = 12/52 (23%), Positives = 21/52 (40%) Frame = -3 Query: 418 FXEPFSRSSFCRRIVSTFESL*SSLDIIPFSGSNILCFLSSAISIFFTCSPS 263 + EP S +++ + + S + PF S ++C F C PS Sbjct: 101 YREPIPTSQLVQKVATVMQEYTQSGGVRPFGVSLLICGWDDGRPYLFQCDPS 152 >AY748836-1|AAV28184.1| 89|Anopheles gambiae cytochrome P450 protein. Length = 89 Score = 23.0 bits (47), Expect = 7.7 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 378 ILLQKEEREKGSXKKTDEALESIQKSIPSSNDDSHRECQGK 500 +LLQ E S + D+ALES S ++ R G+ Sbjct: 19 LLLQARRNELNSEQTEDDALESAGFSTAETHTVEQRGATGE 59 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 7.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 143 VHNRSATATHHSLIP 99 + NRSA T+HS++P Sbjct: 662 LRNRSARNTNHSIVP 676 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 7.7 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 8 SSSYSNSAQPVQKRTKCFLV*FRIKRSTCRTESDYGGSPSR 130 S+S NS Q + + +KR + SD GG PSR Sbjct: 76 SNSRRNSKQLQRDELAAKMGKHDMKRGISQRSSDAGGEPSR 116 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 7.7 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 8 SSSYSNSAQPVQKRTKCFLV*FRIKRSTCRTESDYGGSPSR 130 S+S NS Q + + +KR + SD GG PSR Sbjct: 76 SNSRRNSKQLQRDELAAKMGKHDMKRGISQRSSDAGGEPSR 116 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 506,702 Number of Sequences: 2352 Number of extensions: 9088 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -