BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20176 (571 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41291| Best HMM Match : Piwi (HMM E-Value=0) 58 5e-09 SB_35869| Best HMM Match : Piwi (HMM E-Value=4.6e-12) 56 3e-08 SB_49310| Best HMM Match : Piwi (HMM E-Value=4.9e-33) 47 1e-05 SB_17254| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_9279| Best HMM Match : Piwi (HMM E-Value=0) 40 0.002 SB_33705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17) 28 4.7 SB_28788| Best HMM Match : RVP (HMM E-Value=0.028) 28 4.7 SB_23218| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) 28 4.7 SB_18007| Best HMM Match : RVP (HMM E-Value=0.047) 28 4.7 SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) 28 4.7 SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) 28 4.7 SB_860| Best HMM Match : RVP (HMM E-Value=0.018) 28 4.7 SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22) 28 4.7 SB_46473| Best HMM Match : RVP (HMM E-Value=0.029) 28 4.7 SB_29974| Best HMM Match : RVT_1 (HMM E-Value=3e-17) 28 4.7 SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) 28 4.7 SB_8937| Best HMM Match : RVP (HMM E-Value=0.029) 28 4.7 SB_4291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_59190| Best HMM Match : rve (HMM E-Value=6e-18) 28 6.2 SB_51978| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_13078| Best HMM Match : RVP (HMM E-Value=0.039) 27 8.2 >SB_41291| Best HMM Match : Piwi (HMM E-Value=0) Length = 598 Score = 58.0 bits (134), Expect = 5e-09 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 6/86 (6%) Frame = +2 Query: 17 VMIVGADVTHPSPDQSNIPSIAAVTASMDTKCYIYNIELSIQTPKK-----EMIVQFEDI 181 V+I GADVTHP+P + IPSIAAV AS+D Y + QT K E+IV D+ Sbjct: 256 VIIFGADVTHPAPGDNGIPSIAAVVASLDRNASRYCARVRPQTHMKCKQAQEIIVDLADM 315 Query: 182 MVD-HFHAFKKSQGILPKKVFVFRDG 256 + + +K+++ + P ++ +RDG Sbjct: 316 VKELMIEFYKENKKMKPARIIFYRDG 341 Score = 55.2 bits (127), Expect = 4e-08 Identities = 38/86 (44%), Positives = 45/86 (52%), Gaps = 10/86 (11%) Frame = +1 Query: 256 VSEGQFAEVMKSELTGLH---RAYQRVAGLNAK---PEVLFILVQKRHHTRFFLP-GNNA 414 VSEGQF + M L RA Q+ + K P + F++VQKRHH R F G +A Sbjct: 342 VSEGQFQQTMFRRFQVLLEEVRAVQQACAMLEKDYQPLITFVVVQKRHHARLFAEEGRDA 401 Query: 415 RF---NVDPGTVVDRDIVHPRELDFY 483 R NV GT VD I HP E DFY Sbjct: 402 RGKSRNVPAGTTVDTVICHPFEFDFY 427 >SB_35869| Best HMM Match : Piwi (HMM E-Value=4.6e-12) Length = 243 Score = 55.6 bits (128), Expect = 3e-08 Identities = 27/80 (33%), Positives = 45/80 (56%) Frame = +2 Query: 17 VMIVGADVTHPSPDQSNIPSIAAVTASMDTKCYIYNIELSIQTPKKEMIVQFEDIMVDHF 196 V+ +GADVTHP+ PS+AAV SMD Y + +QT ++E+I + ++ + Sbjct: 53 VIFLGADVTHPAAGDDKRPSVAAVVGSMDAHPSRYYASVRVQTHRQEIIAELAAMVRELL 112 Query: 197 HAFKKSQGILPKKVFVFRDG 256 F +S P+++ +RDG Sbjct: 113 VQFYRSTRHKPQRIVFYRDG 132 >SB_49310| Best HMM Match : Piwi (HMM E-Value=4.9e-33) Length = 952 Score = 46.8 bits (106), Expect = 1e-05 Identities = 31/91 (34%), Positives = 44/91 (48%), Gaps = 5/91 (5%) Frame = +1 Query: 256 VSEGQFAEVMKSELTGLHRAYQRV-AGLNAKPEVLFILVQKRHHTRFFL--PGNNAR--F 420 V EGQ V++ E+ +A++ + G PE+ +VQKR RF+ PG R Sbjct: 771 VGEGQIEAVIQHEIQQFLQAFRSINTGTLYNPELAVTIVQKRILPRFYAVRPGRGGRDYS 830 Query: 421 NVDPGTVVDRDIVHPRELDFYFGVSPSDQGT 513 N PGT+VD + P DF+ QGT Sbjct: 831 NPPPGTLVDTVVTRPHCFDFFLVSQSVRQGT 861 >SB_17254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 41.1 bits (92), Expect = 6e-04 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +2 Query: 17 VMIVGADVTHPSPDQSNIPSIAAVTASMDTKCYIYNIELSIQTPKK 154 V+ +GADVTHP+ PS+AAV SMD Y + +QT ++ Sbjct: 53 VIFLGADVTHPAAGDDKRPSVAAVVGSMDAHPSRYYASVRVQTHRQ 98 >SB_9279| Best HMM Match : Piwi (HMM E-Value=0) Length = 941 Score = 39.5 bits (88), Expect = 0.002 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 5/91 (5%) Frame = +1 Query: 256 VSEGQFAEVMKSELTGLHRAYQRVAGLNAKPEVLFILVQKRHHTRFFL-----PGNNARF 420 V +GQ V++ E+ + +++ P+ F +V+KR TR F+ P Sbjct: 609 VGDGQLRAVIEHEVPQILSTFKQFQD-GYDPKFGFTVVKKRIQTRLFMREARDPDMRNLM 667 Query: 421 NVDPGTVVDRDIVHPRELDFYFGVSPSDQGT 513 N PGTVVD+++ DF+ QGT Sbjct: 668 NPPPGTVVDKEVTRSEWFDFFIVSQSVRQGT 698 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +2 Query: 119 YNIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKVFVFRDG 256 Y + Q +E++ + M +++ G+LP K+ VFRDG Sbjct: 563 YYSRCTFQHSGQELVDGLKVCMTAALRQWQQINGVLPDKIIVFRDG 608 >SB_33705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 846 Score = 35.5 bits (78), Expect = 0.031 Identities = 18/81 (22%), Positives = 39/81 (48%) Frame = +2 Query: 14 AVMIVGADVTHPSPDQSNIPSIAAVTASMDTKCYIYNIELSIQTPKKEMIVQFEDIMVDH 193 ++M+ G DV H S+ + SM+ + ++ Q+P +E+I + +++ Sbjct: 310 SLMVCGIDVYHDKARGGR--SVGGLVCSMNRSLTRWYSDVCFQSPGQELIDGLKMLLIKG 367 Query: 194 FHAFKKSQGILPKKVFVFRDG 256 + LP+++ V+RDG Sbjct: 368 IRKWHDVNNALPERIIVYRDG 388 Score = 34.3 bits (75), Expect = 0.071 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 4/90 (4%) Frame = +1 Query: 256 VSEGQFAEVMKSELTGLHRAYQRVAGLNAKPEVLFILVQKRHHTRFFLP---GNNARF-N 423 V +GQ V E+ + G + KP++ ++VQKR +TR F G R N Sbjct: 389 VGDGQLKVVAGYEVQQFEECFASF-GESYKPKLAVLVVQKRINTRIFSAEGRGPQPRLGN 447 Query: 424 VDPGTVVDRDIVHPRELDFYFGVSPSDQGT 513 PG+V+D + DF+ QGT Sbjct: 448 PGPGSVLDHTVTRKDWNDFFLVSQHVRQGT 477 >SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +3 Query: 63 VIYRVS-PP*PPRWIRNATYITSN*AYRHRRKR 158 VI +V PP P W+ +AT+ ++ AYR+RR R Sbjct: 177 VINKVKYPPSPQDWMPSATHRLNDQAYRYRRPR 209 >SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17) Length = 635 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 109 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 147 >SB_28788| Best HMM Match : RVP (HMM E-Value=0.028) Length = 278 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 161 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 199 >SB_23218| Best HMM Match : zf-CCHC (HMM E-Value=0.00066) Length = 557 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 382 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 420 >SB_18007| Best HMM Match : RVP (HMM E-Value=0.047) Length = 202 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 161 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 199 >SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 161 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 199 >SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) Length = 1432 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 277 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 315 >SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) Length = 609 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 299 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 337 >SB_860| Best HMM Match : RVP (HMM E-Value=0.018) Length = 260 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 143 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 181 >SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22) Length = 800 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 109 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 147 >SB_46473| Best HMM Match : RVP (HMM E-Value=0.029) Length = 304 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 161 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 199 >SB_29974| Best HMM Match : RVT_1 (HMM E-Value=3e-17) Length = 890 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 109 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 147 >SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17) Length = 649 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 333 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 371 >SB_8937| Best HMM Match : RVP (HMM E-Value=0.029) Length = 303 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 161 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 199 >SB_4291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 57 NIDLSREQSKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 95 >SB_59190| Best HMM Match : rve (HMM E-Value=6e-18) Length = 660 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 161 NIDLSREQGKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 199 >SB_51978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 Query: 298 SVHSSLPQQIDPQKPVTEHEHLLRQNPLTFLESMEMIHHYILK 170 S+ SS P P H H NP +L ++ HH I+K Sbjct: 90 SLPSSQPTPSSPHHQKQSHHHF-HHNPYHYLRHSQLHHHPIIK 131 >SB_13078| Best HMM Match : RVP (HMM E-Value=0.039) Length = 251 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 122 NIELSIQTPKKEMIVQFEDIMVDHFHAFKKSQGILPKKV 238 NI+LS + K + + ++ D+ F G+LP KV Sbjct: 161 NIDLSREQIKSTTTLTSDPVLKDYLDCFSNKPGMLPNKV 199 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,659,107 Number of Sequences: 59808 Number of extensions: 401505 Number of successful extensions: 978 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 976 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -