BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20175 (572 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 24 4.0 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 7.1 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.8 bits (49), Expect = 4.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 157 PQTPYGGLTPILPPA 113 PQ+PYG L PPA Sbjct: 227 PQSPYGALPETPPPA 241 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.0 bits (47), Expect = 7.1 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = -2 Query: 391 PMSISRSNRPKRRSAGSMEFGRFVAAITITWD 296 P+ + +SN + FG++V +T+ +D Sbjct: 279 PLVVKKSNNHTVLITQARSFGKYVGRLTVNFD 310 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 515,725 Number of Sequences: 2352 Number of extensions: 9748 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -