BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20164 (508 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 68 4e-12 At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 63 1e-10 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 63 1e-10 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 62 2e-10 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 58 3e-09 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 55 2e-08 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 52 2e-07 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 52 2e-07 At3g55640.1 68416.m06182 mitochondrial substrate carrier family ... 47 6e-06 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 45 3e-05 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 45 3e-05 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 44 4e-05 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 43 1e-04 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 42 2e-04 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 41 4e-04 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 40 0.001 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 40 0.001 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 39 0.002 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 38 0.004 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 38 0.004 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 36 0.012 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 36 0.016 At2g46320.1 68415.m05761 mitochondrial substrate carrier family ... 36 0.021 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 36 0.021 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 35 0.036 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 34 0.048 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 34 0.048 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 33 0.11 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 33 0.11 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 33 0.15 At5g64970.1 68418.m08172 mitochondrial substrate carrier family ... 32 0.19 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 32 0.19 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 32 0.19 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 32 0.26 At4g24570.1 68417.m03521 mitochondrial substrate carrier family ... 31 0.34 At4g03115.1 68417.m00424 mitochondrial substrate carrier family ... 31 0.45 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 31 0.59 At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) id... 31 0.59 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 31 0.59 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 30 0.78 At4g27940.1 68417.m04009 mitochondrial substrate carrier family ... 30 0.78 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 29 1.4 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 29 1.8 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 29 1.8 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 29 1.8 At5g42130.1 68418.m05129 mitochondrial substrate carrier family ... 29 2.4 At4g39460.1 68417.m05583 mitochondrial substrate carrier family ... 29 2.4 At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 28 3.1 At1g28320.1 68414.m03475 protease-related similar to Protease de... 28 3.1 At1g07030.1 68414.m00749 mitochondrial substrate carrier family ... 28 3.1 At1g07630.1 68414.m00818 protein phosphatase 2C family protein /... 28 4.2 At2g21040.1 68415.m02495 C2 domain-containing protein low simila... 27 5.5 At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic c... 27 9.6 At2g17090.1 68415.m01973 protein kinase family protein similar t... 27 9.6 At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic c... 27 9.6 At1g07980.1 68414.m00869 histone-like transcription factor (CBF/... 27 9.6 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 67.7 bits (158), Expect = 4e-12 Identities = 34/59 (57%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 G+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G+L+ WRG Sbjct: 87 GVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGMLALWRG 145 Score = 35.1 bits (77), Expect = 0.027 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 431 NFANVIRYFPTQALNF 478 N ANVIRYFPTQALNF Sbjct: 146 NTANVIRYFPTQALNF 161 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 62.9 bits (146), Expect = 1e-10 Identities = 34/59 (57%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 G+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G S WRG Sbjct: 88 GVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRG 146 Score = 35.1 bits (77), Expect = 0.027 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 431 NFANVIRYFPTQALNF 478 N ANVIRYFPTQALNF Sbjct: 147 NTANVIRYFPTQALNF 162 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 62.9 bits (146), Expect = 1e-10 Identities = 34/59 (57%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 G+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G S WRG Sbjct: 88 GVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRG 146 Score = 35.1 bits (77), Expect = 0.027 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 431 NFANVIRYFPTQALNF 478 N ANVIRYFPTQALNF Sbjct: 147 NTANVIRYFPTQALNF 162 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 62.1 bits (144), Expect = 2e-10 Identities = 33/59 (55%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 G+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R +++G+ S WRG Sbjct: 92 GVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRG 150 Score = 35.1 bits (77), Expect = 0.027 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 431 NFANVIRYFPTQALNF 478 N ANVIRYFPTQALNF Sbjct: 151 NTANVIRYFPTQALNF 166 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 58.0 bits (134), Expect = 3e-09 Identities = 31/59 (52%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 G +A V+K+A APIERVKLLLQ Q + K + Y G+ + F RI +E+G+LSFWRG Sbjct: 18 GAAAIVAKSAAAPIERVKLLLQNQGEMIKTGHLIRPYTGLGNCFTRIYREEGVLSFWRG 76 Score = 34.7 bits (76), Expect = 0.036 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +2 Query: 431 NFANVIRYFPTQALNFRLQG 490 N ANVIRYFPTQA NF +G Sbjct: 77 NQANVIRYFPTQASNFAFKG 96 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 55.2 bits (127), Expect = 2e-08 Identities = 25/73 (34%), Positives = 43/73 (58%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKLR 438 ++ A +KT AP++R+KLL+Q + + ++ G ++A I KE+G+ +W+G L Sbjct: 96 LAGAAAKTVTAPLDRIKLLMQTHGIRLGQQSAKKAIGFIEAITLIAKEEGVKGYWKGNLP 155 Query: 439 QRHQVLPDPGAQL 477 Q +VLP QL Sbjct: 156 QVIRVLPYSAVQL 168 Score = 29.5 bits (63), Expect = 1.4 Identities = 19/74 (25%), Positives = 35/74 (47%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKLR 438 +SA ++ P++ V+ +Q++ YK I +AF I GL+ +RG L Sbjct: 286 LSAGIATLTCYPLDTVRRQMQMRGTP--------YKSIPEAFAGIIDRDGLIGLYRGFLP 337 Query: 439 QRHQVLPDPGAQLS 480 + LP+ +L+ Sbjct: 338 NALKTLPNSSIRLT 351 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 52.0 bits (119), Expect = 2e-07 Identities = 28/63 (44%), Positives = 36/63 (57%), Gaps = 6/63 (9%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ------RYKGIVDAFVRIPKEQGLLSF 420 + V T VAPIER KLLLQ Q + I D+ R+KG+ D R +E+G+LS Sbjct: 39 VMGGVVHTIVAPIERAKLLLQTQESNIAIVGDEGHAGKRRFKGMFDFIFRTVREEGVLSL 98 Query: 421 WRG 429 WRG Sbjct: 99 WRG 101 Score = 26.6 bits (56), Expect = 9.6 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +2 Query: 431 NFANVIRYFPTQALNFRLQ 487 N ++V+RY+P+ ALNF L+ Sbjct: 102 NGSSVLRYYPSVALNFSLK 120 Score = 26.6 bits (56), Expect = 9.6 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 361 YKGIVDAFVRIPKEQGLLSFWRGKL 435 Y+ +D + +I + +GL SF+RG L Sbjct: 278 YRSTLDCWKKIYRSEGLASFYRGAL 302 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 52.0 bits (119), Expect = 2e-07 Identities = 23/72 (31%), Positives = 42/72 (58%) Frame = +1 Query: 262 SAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKLRQ 441 + A +K+ AP++R+KLL+Q V + ++ G ++A I KE+G+ +W+G L Q Sbjct: 125 AGAAAKSVTAPLDRIKLLMQTHGVRAGQQSAKKAIGFIEAITLIGKEEGIKGYWKGNLPQ 184 Query: 442 RHQVLPDPGAQL 477 +++P QL Sbjct: 185 VIRIVPYSAVQL 196 Score = 27.9 bits (59), Expect = 4.2 Identities = 19/114 (16%), Positives = 53/114 (46%) Frame = +1 Query: 139 PSACAATPTSTYSPSEDHIIEQNVEPRRSGRVR*GLPGCGISAAVSKTAVAPIERVKLLL 318 PS + P + ++++++ + + + L ++AA++ P++ ++ + Sbjct: 274 PSLLSIAPYIAINFCVFDLVKKSLPEKYQQKTQSSLLTAVVAAAIATGTCYPLDTIRRQM 333 Query: 319 QVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKLRQRHQVLPDPGAQLS 480 Q++ YK ++DAF I +G++ +RG + + +P+ +L+ Sbjct: 334 QLKGTP--------YKSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLT 379 >At3g55640.1 68416.m06182 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 332 Score = 47.2 bits (107), Expect = 6e-06 Identities = 25/60 (41%), Positives = 35/60 (58%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 G++ A SKT AP+ R+ +L QVQ + AA R I+ RI E+GL +FW+G L Sbjct: 42 GLAGAFSKTCTAPLSRLTILFQVQGMHTNAAA-LRKPSILHEASRILNEEGLKAFWKGNL 100 Score = 32.3 bits (70), Expect = 0.19 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = +1 Query: 253 CG-ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYK-GIVDAFVRIPKEQGLLSFWR 426 CG +S S TA P++ V+ Q++ + + YK G++ RI + +G +R Sbjct: 242 CGSLSGIASSTATFPLDLVRRRKQLEGIGGRAVV---YKTGLLGTLKRIVQTEGARGLYR 298 Query: 427 GKLRQRHQVLPDPG 468 G L + ++V+P G Sbjct: 299 GILPEYYKVVPGVG 312 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 45.2 bits (102), Expect = 3e-05 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 G++ VS+TAVAP+ER+K+LLQVQ+ + +Y G V I + +GL ++G Sbjct: 46 GVAGGVSRTAVAPLERMKILLQVQN-----PHNIKYSGTVQGLKHIWRTEGLRGLFKGNG 100 Query: 436 RQRHQVLPD 462 +++P+ Sbjct: 101 TNCARIVPN 109 Score = 30.7 bits (66), Expect = 0.59 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 1/78 (1%) Frame = +1 Query: 250 GCGISAAV-SKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWR 426 G G +A + + +A P++ V+ L VQ + + +Y+GI A + +E+G + +R Sbjct: 146 GAGATAGIIAMSATYPMDMVRGRLTVQTAN----SPYQYRGIAHALATVLREEGPRALYR 201 Query: 427 GKLRQRHQVLPDPGAQLS 480 G L V+P G S Sbjct: 202 GWLPSVIGVVPYVGLNFS 219 Score = 27.1 bits (57), Expect = 7.3 Identities = 19/79 (24%), Positives = 40/79 (50%), Gaps = 10/79 (12%) Frame = +1 Query: 253 CG-ISAAVSKTAVAPIERVKLLLQV---QHVSKQIAADQR------YKGIVDAFVRIPKE 402 CG I+ V +T P++ ++ +Q+ + S + + R Y G+VDAF + + Sbjct: 250 CGAIAGTVGQTIAYPLDVIRRRMQMVGWKDASAIVTGEGRSTASLEYTGMVDAFRKTVRH 309 Query: 403 QGLLSFWRGKLRQRHQVLP 459 +G + ++G + +V+P Sbjct: 310 EGFGALYKGLVPNSVKVVP 328 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 44.8 bits (101), Expect = 3e-05 Identities = 24/60 (40%), Positives = 34/60 (56%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 GI+ A SKT AP+ R+ +L Q+Q + + AA I RI KE+G +FW+G L Sbjct: 77 GIAGAFSKTCTAPLARLTILFQIQGMQSE-AAILSSPNIWHEASRIVKEEGFRAFWKGNL 135 Score = 36.3 bits (80), Expect = 0.012 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 1/74 (1%) Frame = +1 Query: 250 GCG-ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWR 426 GCG +S VS TA P++ V+ +Q++ + A G+ F I K +G+ +R Sbjct: 276 GCGSLSGIVSSTATFPLDLVRRRMQLEGAGGR--ARVYTTGLFGTFKHIFKTEGMRGLYR 333 Query: 427 GKLRQRHQVLPDPG 468 G + + ++V+P G Sbjct: 334 GIIPEYYKVVPGVG 347 Score = 27.9 bits (59), Expect = 4.2 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 G++ + +A P++ V+ L Q S Y+G+ AF I +E+G+L ++G Sbjct: 184 GLAGLTAASATYPLDLVRTRLSAQRNSIY------YQGVGHAFRTICREEGILGLYKG 235 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 44.4 bits (100), Expect = 4e-05 Identities = 22/68 (32%), Positives = 41/68 (60%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 G++ ++KTAVAP+ER+K+L Q + + + G+V + +I K +GL+ F+RG Sbjct: 25 GVTGGIAKTAVAPLERIKILFQTRR------DEFKRIGLVGSINKIGKTEGLMGFYRGNG 78 Query: 436 RQRHQVLP 459 +++P Sbjct: 79 ASVARIVP 86 Score = 34.3 bits (75), Expect = 0.048 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +1 Query: 292 PIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGLLSFWRGKLRQRHQVLPDPG 468 P++ V+ L Q K I +Q Y+GIVD F R +E G +RG + + P G Sbjct: 133 PLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFPYAG 192 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 42.7 bits (96), Expect = 1e-04 Identities = 26/95 (27%), Positives = 46/95 (48%) Frame = +1 Query: 151 AATPTSTYSPSEDHIIEQNVEPRRSGRVR*GLPGCGISAAVSKTAVAPIERVKLLLQVQH 330 A + +T + ++ ++P+ L GI+ A+SKT AP+ R+ +L Q+Q Sbjct: 14 AQSALNTATTVHSSVVMTQIKPQAKLGTFQNLLAGGIAGAISKTCTAPLARLTILFQLQG 73 Query: 331 VSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 + + A R + RI E+G +FW+G L Sbjct: 74 MQSEGAVLSR-PNLRREASRIINEEGYRAFWKGNL 107 Score = 37.1 bits (82), Expect = 0.007 Identities = 22/71 (30%), Positives = 37/71 (52%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 G++ AVS TA P++ V+ +QV+ + A G+ F I K +G +RG L Sbjct: 251 GLAGAVSSTATYPLDLVRRRMQVEGAGGR--ARVYNTGLFGTFKHIFKSEGFKGIYRGIL 308 Query: 436 RQRHQVLPDPG 468 + ++V+P G Sbjct: 309 PEYYKVVPGVG 319 Score = 27.1 bits (57), Expect = 7.3 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 G++ + TA P++ V+ L Q + Y+GI F I +E+G+L ++G Sbjct: 156 GLAGITAATATYPLDLVRTRLAAQRNAIY------YQGIEHTFRTICREEGILGLYKG 207 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 42.3 bits (95), Expect = 2e-04 Identities = 26/69 (37%), Positives = 39/69 (56%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 GI+ AVS+TA AP++R+K+ LQVQ + G+V +I +E LL F+RG Sbjct: 212 GIAGAVSRTATAPLDRLKVALQVQRTN---------LGVVPTIKKIWREDKLLGFFRGNG 262 Query: 436 RQRHQVLPD 462 +V P+ Sbjct: 263 LNVAKVAPE 271 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 41.1 bits (92), Expect = 4e-04 Identities = 23/69 (33%), Positives = 41/69 (59%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 G++ AVS+TA AP++R+K++LQVQ + + G++ +I +E L+ F+RG Sbjct: 213 GLAGAVSRTATAPLDRLKVVLQVQ---------RAHAGVLPTIKKIWREDKLMGFFRGNG 263 Query: 436 RQRHQVLPD 462 +V P+ Sbjct: 264 LNVMKVAPE 272 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 39.9 bits (89), Expect = 0.001 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 8/82 (9%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQH--------VSKQIAADQRYKGIVDAFVRIPKEQGLL 414 IS VS++ +P++ +K+ QVQ V ++ +Y G+V A I +E+G Sbjct: 27 ISGGVSRSVTSPLDVIKIRFQVQLEPTTSWGLVRGNLSGASKYTGMVQATKDIFREEGFR 86 Query: 415 SFWRGKLRQRHQVLPDPGAQLS 480 FWRG + V+P Q + Sbjct: 87 GFWRGNVPALLMVMPYTSIQFT 108 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/68 (30%), Positives = 39/68 (57%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 G + A++KTAVAP+ER+K+LLQ + D + G+ + ++ + G L F++G Sbjct: 31 GAAGAIAKTAVAPLERIKILLQTR------TNDFKTLGVSQSLKKVLQFDGPLGFYKGNG 84 Query: 436 RQRHQVLP 459 +++P Sbjct: 85 ASVIRIIP 92 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 38.7 bits (86), Expect = 0.002 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 6/81 (7%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQ------HVSKQIAADQRYKGIVDAFVRIPKEQGLLS 417 G++ A+S+ +P++ +K+ QVQ K +Y G+ I +E+GL Sbjct: 23 GVAGAISRMVTSPLDVIKIRFQVQLEPTATWALKDSQLKPKYNGLFRTTKDIFREEGLSG 82 Query: 418 FWRGKLRQRHQVLPDPGAQLS 480 FWRG + V+P Q + Sbjct: 83 FWRGNVPALLMVVPYTSIQFA 103 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 37.9 bits (84), Expect = 0.004 Identities = 24/69 (34%), Positives = 38/69 (55%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 GI+ A S+TA AP++R+K+LLQ+Q +I +A I K+ G+ F+RG Sbjct: 216 GIAGAASRTATAPLDRLKVLLQIQKTDARIR---------EAIKLIWKQGGVRGFFRGNG 266 Query: 436 RQRHQVLPD 462 +V P+ Sbjct: 267 LNIVKVAPE 275 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 G S +++ +P + VK+ +Q RY G ++AF +I + +G+ W+G L Sbjct: 122 GFSGVIAQVVASPADLVKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVL 181 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 36.3 bits (80), Expect = 0.012 Identities = 21/56 (37%), Positives = 30/56 (53%) Frame = +1 Query: 292 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKLRQRHQVLP 459 P + VK L Q S+ RYKG+V A I E+GL++ WRG L + ++ P Sbjct: 230 PFDVVKTRLMAQ--SRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLPRLMRIPP 283 Score = 30.7 bits (66), Expect = 0.59 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +1 Query: 244 LPGCGISAAVSKTAVAPIERVKLLLQVQH-VSKQIAADQRYKGIVDAFVRIPKEQGLLSF 420 L G G + V P E VK+ LQ Q +S ++ +YKG + I +E+ +L Sbjct: 112 LSGFGAGVLEALAIVTPFEVVKIRLQQQKGLSPELF---KYKGPIHCARTIVREESILGL 168 Query: 421 WRG 429 W G Sbjct: 169 WSG 171 Score = 26.6 bits (56), Expect = 9.6 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 + V + PI+ +K LQ+ V YKGI ++ + +G+ + W+G Sbjct: 22 LGGVVEACCLQPIDVIKTRLQLDRVGA-------YKGIAHCGSKVVRTEGVRALWKG 71 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 35.9 bits (79), Expect = 0.016 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Frame = +1 Query: 262 SAAVSKTAVAPIERVKLLLQVQHVSKQIAAD---QRYKGIVDAFVRIPKEQGLLSFWRGK 432 +A V + P++ K+ LQ+Q +A D +Y+G++ I +E+GL S W+G Sbjct: 21 AACVGEVCTIPLDTAKVRLQLQ--KSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGV 78 Query: 433 LRQRHQ 450 + H+ Sbjct: 79 VPGLHR 84 Score = 30.3 bits (65), Expect = 0.78 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +1 Query: 292 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 P + VK+ LQ + A +RY G ++A+ I +++G+ + W G Sbjct: 134 PTDLVKVRLQAEG-KLAAGAPRRYSGALNAYSTIVRQEGVRALWTG 178 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 334 SKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 S+ + YKG +D FV+ K G ++F++G Sbjct: 240 SRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKG 271 >At2g46320.1 68415.m05761 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 361 Score = 35.5 bits (78), Expect = 0.021 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 334 SKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKLRQRHQVLPDPG 468 S + +D +YKG +D F +I +++G WRG +P G Sbjct: 91 SASVCSDNQYKGTLDVFYKIIRQEGFSRLWRGTNASLTLAIPTVG 135 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 35.5 bits (78), Expect = 0.021 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = +1 Query: 250 GCGISA-AVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWR 426 G G +A A++ T V P++ +K LQV + + A+ QR I+ + I KE+G +R Sbjct: 22 GAGATAGAIAATFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYR 81 Query: 427 G 429 G Sbjct: 82 G 82 Score = 29.1 bits (62), Expect = 1.8 Identities = 13/57 (22%), Positives = 29/57 (50%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 I+ ++ P E ++ LQ Q + A+ +Y G++D ++ + +G+ +RG Sbjct: 226 IAKVIASILTYPHEVIRAKLQEQGQIRN--AETKYSGVIDCITKVFRSEGIPGLYRG 280 Score = 27.9 bits (59), Expect = 4.2 Identities = 20/64 (31%), Positives = 29/64 (45%) Frame = +1 Query: 244 LPGCGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 423 + G AA S A P+ VK L Q + + YK ++ AF RI E+G+ + Sbjct: 122 IAAAGAGAATS-IATNPLWVVKTRLMTQGIRPGVVP---YKSVMSAFSRICHEEGVRGLY 177 Query: 424 RGKL 435 G L Sbjct: 178 SGIL 181 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 34.7 bits (76), Expect = 0.036 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 +S ++ TA+ P++ +K +Q+ + +YK I AF KEQGL F RG Sbjct: 76 LSCGITHTAITPLDVIKCNMQIDPL--------KYKNITSAFKTTIKEQGLKGFTRG 124 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 34.3 bits (75), Expect = 0.048 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 I+ AV P + + +Q S + + YK +VDA RI +++G+ S WRG Sbjct: 156 IAGAVGSVVGNPADVAMVRMQADG-SLPLNRRRNYKSVVDAIDRIARQEGVSSLWRG 211 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 34.3 bits (75), Expect = 0.048 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +1 Query: 256 GISAAVSKTAVA-PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 G A VS+T + P+E VK L +Q YKGI DAF++I +E+G +RG Sbjct: 211 GACAGVSQTLLTYPLELVKTRLTIQRGV--------YKGIFDAFLKIIREEGPTELYRG 261 Score = 33.9 bits (74), Expect = 0.063 Identities = 18/57 (31%), Positives = 34/57 (59%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 ++ A+S TA P+E + +QV VS ++ YK ++ A V I + +G+L +++G Sbjct: 307 LAGALSSTATFPLEVARKHMQVGAVSGRVV----YKNMLHALVTILEHEGILGWYKG 359 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 33.1 bits (72), Expect = 0.11 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = +1 Query: 244 LPGCGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 423 +P A+ + P E VK +Q+Q + +RY +D V+ K G+ + Sbjct: 117 VPSAMFGGAIISFVLCPTELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIF 176 Query: 424 RG 429 RG Sbjct: 177 RG 178 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 33.1 bits (72), Expect = 0.11 Identities = 22/59 (37%), Positives = 32/59 (54%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 ++A VSKT +AP+ER+KL V+ +QR ++ I QGL FW+G L Sbjct: 57 VAAMVSKTFLAPLERLKLEYTVR-------GEQR--NLLVVAKSIATTQGLTGFWKGNL 106 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 32.7 bits (71), Expect = 0.15 Identities = 23/73 (31%), Positives = 38/73 (52%) Frame = +1 Query: 241 GLPGCGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSF 420 GL G++ +S P++ VK LQVQ + +YKG +DA +I +++G F Sbjct: 254 GLVLGGLAGGLSAYLTTPLDVVKTRLQVQ------GSTIKYKGWLDAVGQIWRKEGPQGF 307 Query: 421 WRGKLRQRHQVLP 459 +RG + + LP Sbjct: 308 FRGSVPRVMWYLP 320 >At5g64970.1 68418.m08172 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 428 Score = 32.3 bits (70), Expect = 0.19 Identities = 18/58 (31%), Positives = 34/58 (58%) Frame = +1 Query: 262 SAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGKL 435 +A VS+T +AP+ER+KL +++ + +Q +++ RI +G+ FW+G L Sbjct: 141 AAMVSRTCIAPLERMKL----EYI---VRGEQ--GNLLELIQRIATNEGIRGFWKGNL 189 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 32.3 bits (70), Expect = 0.19 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 ++ A++ P + VK+ LQ + +RY G VDA+ I K +G+ + W G Sbjct: 125 LTGAIAIIVANPTDLVKVRLQSEG-KLPAGVPRRYAGAVDAYFTIVKLEGVSALWTG 180 Score = 31.1 bits (67), Expect = 0.45 Identities = 14/65 (21%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +1 Query: 262 SAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ--RYKGIVDAFVRIPKEQGLLSFWRGKL 435 +A ++ P++ K+ LQ+Q + +Y+G + I +E+G+ W+G + Sbjct: 22 AACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVI 81 Query: 436 RQRHQ 450 H+ Sbjct: 82 AGLHR 86 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 32.3 bits (70), Expect = 0.19 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 ++ A++ P + VK+ LQ + +RY G VDA+ I K +G+ + W G Sbjct: 125 LTGAIAIIVANPTDLVKVRLQSEG-KLPAGVPRRYAGAVDAYFTIVKLEGVSALWTG 180 Score = 31.1 bits (67), Expect = 0.45 Identities = 14/65 (21%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +1 Query: 262 SAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ--RYKGIVDAFVRIPKEQGLLSFWRGKL 435 +A ++ P++ K+ LQ+Q + +Y+G + I +E+G+ W+G + Sbjct: 22 AACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVI 81 Query: 436 RQRHQ 450 H+ Sbjct: 82 AGLHR 86 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 31.9 bits (69), Expect = 0.26 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 G++ S A P++ VK LQ H + Y+GI D F + K++G WRG Sbjct: 208 GLAGVASWVACYPLDVVKTRLQQGHGA--------YEGIADCFRKSVKQEGYTVLWRG 257 >At4g24570.1 68417.m03521 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 31.5 bits (68), Expect = 0.34 Identities = 24/86 (27%), Positives = 41/86 (47%) Frame = +1 Query: 223 SGRVR*GLPGCGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKE 402 S ++ GL GI AAV A + R++ ++ +A + Y G+ DA + K Sbjct: 127 SRKIGAGLVAGGIGAAVGNPADVAMVRMQADGRLP-----LAQRRNYAGVGDAIRSMVKG 181 Query: 403 QGLLSFWRGKLRQRHQVLPDPGAQLS 480 +G+ S WRG ++ + AQL+ Sbjct: 182 EGVTSLWRGSALTINRAMIVTAAQLA 207 >At4g03115.1 68417.m00424 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 341 Score = 31.1 bits (67), Expect = 0.45 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 GIS A++ P++ VK+ LQ+QHV ++ G+ F+++ K +G S + G Sbjct: 71 GISVALATGVTHPLDVVKVRLQMQHVGQR----GPLIGMTGIFLQLMKNEGRRSLYLG 124 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 30.7 bits (66), Expect = 0.59 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +1 Query: 292 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 PI VK LQ+Q Q Q Y G++DAF I KE+G + ++G Sbjct: 126 PIWLVKTRLQLQTPLHQT---QPYSGLLDAFRTIVKEEGPRALYKG 168 >At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) identical to 36kDa-peroxisomal membrane protein (PMP36) GI:15146342 from [Arabidopsis thaliana] Length = 331 Score = 30.7 bits (66), Expect = 0.59 Identities = 16/46 (34%), Positives = 28/46 (60%) Frame = +1 Query: 292 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 P+ VK LQ + V+ Q+YKG +DA +++ + +GL F++G Sbjct: 251 PLLVVKSRLQAKQVTTGDKR-QQYKGTLDAILKMIRYEGLYGFYKG 295 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 30.7 bits (66), Expect = 0.59 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +1 Query: 262 SAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 + AV+ P++ +K L VQ Q YKG+ D I +E+G + W+G Sbjct: 242 AGAVTGVLTTPLDVIKTRLMVQGSGTQ------YKGVSDCIKTIIREEGSSALWKG 291 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 30.3 bits (65), Expect = 0.78 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +1 Query: 256 GISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 G++ A V P + VK +LQV + RY G +DAF +I K +G+ ++G Sbjct: 221 GVAGASFWGIVYPTDVVKSVLQVDDYK-----NPRYTGSMDAFRKILKSEGVKGLYKG 273 >At4g27940.1 68417.m04009 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 413 Score = 30.3 bits (65), Expect = 0.78 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 358 RYKGIVDAFVRIPKEQGLLSFWRG 429 +YKG D F +I +++GL WRG Sbjct: 145 QYKGTFDVFTKIIRQEGLGRLWRG 168 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 84 RNYSKSPVQKSGVSVS*SPIRVCRNS 161 R S+SPV+ S SVS SPIR+ R S Sbjct: 593 RRISRSPVRSSRKSVSRSPIRLSRRS 618 Score = 27.1 bits (57), Expect = 7.3 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +3 Query: 84 RNYSKSPVQKSGVSVS*SPIRVCRNSHLDIFT**RSHNRTKCRTSPIRSRSLR 242 ++ S+SP++ S S+S SPIR+ R S R R P R RS+R Sbjct: 605 KSVSRSPIRLSRRSISRSPIRLSRRSISRSPV--RGRRRISRSPVPARRRSVR 655 Score = 26.6 bits (56), Expect = 9.6 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +3 Query: 84 RNYSKSPVQKSGVSVS*SPIRVCRNSHLDIFT**RSHNRTKCRTSPIRS 230 R+ S+SPV+ S S+S SPI++ R S T R R+ R SPIRS Sbjct: 521 RSPSRSPVRSSRRSLSRSPIQLSRRSLSRSPT--RLSRRSLSR-SPIRS 566 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 29.1 bits (62), Expect = 1.8 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 256 GISAAVSKTAV-APIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 423 G+ A +S AV P++ VK LQ+ + YKG+ D R+ +E+G +F+ Sbjct: 139 GVFATISSDAVFTPMDMVKQRLQI--------GNGTYKGVWDCIKRVTREEGFGAFY 187 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 29.1 bits (62), Expect = 1.8 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +1 Query: 250 GCGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGLLSFWR 426 G G A AV V ++ ++Q + D+R YK ++DA ++ + +G+ S WR Sbjct: 124 GAGAIAGAIGAAVGNPADVAMV-RMQADGRLPLTDRRNYKSVLDAITQMIRGEGVTSLWR 182 Query: 427 G 429 G Sbjct: 183 G 183 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +1 Query: 283 AVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 A+ P E +K+ +Q Q + KG++D F R+ + +GL F RG Sbjct: 128 ALCPFEAIKVRVQTQPMFA--------KGLLDGFPRVYRSEGLAGFHRG 168 >At5g42130.1 68418.m05129 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 412 Score = 28.7 bits (61), Expect = 2.4 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = +1 Query: 253 CG-ISAAVSKTAVAPIERVKLLLQVQ-HVSK-QIAADQRYKGIVDAFVRIPKEQGLLSFW 423 CG ++ A+S + P++ VK L Q HV Y G+ +I E+G + F Sbjct: 306 CGALAGAISASITTPLDVVKTRLMTQIHVEAVDKLGGAMYTGVAGTVKQILTEEGWVGFT 365 Query: 424 RG 429 RG Sbjct: 366 RG 367 >At4g39460.1 68417.m05583 mitochondrial substrate carrier family protein Length = 325 Score = 28.7 bits (61), Expect = 2.4 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +1 Query: 262 SAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 + A++ P++ +K L VQ +KQ Y+GIVD I +E+G + +G Sbjct: 236 AGALTGAVTTPLDVIKTRLMVQGSAKQ------YQGIVDCVQTIVREEGAPALLKG 285 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 28.3 bits (60), Expect = 3.1 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 259 ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 429 +S ++ V P++ VK +Q+ +YK I F + KEQG+ F+RG Sbjct: 87 LSCGLTHMTVTPLDLVKCNMQIDPA--------KYKSISSGFGILLKEQGVKGFFRG 135 >At1g28320.1 68414.m03475 protease-related similar to Protease degS [Precursor] (SP:P44947) [Haemophilus influenzae]; similar to DegP protease precursor (GI:2565436) [Arabidopsis thaliana] Length = 709 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 247 PGCGISAAVSKTAVAPIERVKLLLQVQHVSKQIA 348 P CG+S ++ VA + K L Q +S+++A Sbjct: 530 PRCGLSPSICSGVVAKVVHAKRRLNTQSISQEVA 563 >At1g07030.1 68414.m00749 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 326 Score = 28.3 bits (60), Expect = 3.1 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 256 GISAAVSKTAV-APIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 423 G+ A +S AV P++ VK LQ+ + YKG+ D R+ +E+G+ +F+ Sbjct: 137 GVFATISSDAVFTPMDMVKQRLQM--------GEGTYKGVWDCVKRVLREEGIGAFY 185 >At1g07630.1 68414.m00818 protein phosphatase 2C family protein / PP2C family protein similar to protein phosphatase-2c (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain Length = 662 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -1 Query: 490 SLKAKVERLGREVPDDVGEVYHARMKG 410 +++ +VER+ E PDDV V + R+KG Sbjct: 495 NIEEEVERIRNEHPDDVTAVTNERVKG 521 >At2g21040.1 68415.m02495 C2 domain-containing protein low similarity to phloem protein [Cucurbita maxima] GI:4164541; contains Pfam profile PF00168: C2 domain Length = 261 Score = 27.5 bits (58), Expect = 5.5 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 330 RQQADRRRPALQGYRRCLRPYPQGAGSPFILAW 428 RQ+A R+ L G R P QGAGS + W Sbjct: 197 RQEAVRQGAGLSGSRFVKEPVRQGAGSSGVGVW 229 >At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP|O43684)[Homo sapiens] Length = 340 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 333 QQADRRRPALQGYRRCLRPYPQGAG 407 Q RR +L+ RC+R YP G G Sbjct: 176 QPEQRRESSLKYQTRCVRCYPNGTG 200 >At2g17090.1 68415.m01973 protein kinase family protein similar to Arabidopsis thaliana APK1A [SP|Q06548], APK1B [SP|P46573]; contains Pfam profile: PF00069 Protein kinase domain Length = 465 Score = 26.6 bits (56), Expect = 9.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 148 CAATPTSTYSPSEDHIIEQNVEPRRSG 228 C + +ST P +DH + + EPR G Sbjct: 3 CCYSLSSTVDPVQDHTTDASSEPRNGG 29 >At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP:O43684)[Homo sapiens] Length = 339 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 333 QQADRRRPALQGYRRCLRPYPQGAG 407 Q RR +L+ RC+R YP G G Sbjct: 175 QPEQRRESSLKYQTRCVRCYPNGTG 199 >At1g07980.1 68414.m00869 histone-like transcription factor (CBF/NF-Y) family protein contains Pfam profile PF00808: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to Chromatin accessibility complex protein 1 (CHRAC-1) (CHRAC-15) (HuCHRAC15) (DNA polymerase epsilon subunit p15) (SP:Q9NRG0) {Homo sapiens} Length = 206 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 307 KLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 423 K + +H+S ++ DQRY+ + D+ K + L W Sbjct: 160 KKFIHYKHLSSVVSNDQRYEFLADSVPEKLKAEAALEEW 198 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,892,528 Number of Sequences: 28952 Number of extensions: 220772 Number of successful extensions: 731 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -