BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20161 (338 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4UAB3 Cluster: Putative uncharacterized protein; n=1; ... 35 0.31 UniRef50_Q8I620 Cluster: Putative uncharacterized protein; n=1; ... 31 5.1 UniRef50_A5DPY8 Cluster: Putative uncharacterized protein; n=1; ... 31 6.7 UniRef50_P0A461 Cluster: Modification methylase AvaI (EC 2.1.1.1... 31 6.7 UniRef50_Q4S249 Cluster: Chromosome undetermined SCAF14764, whol... 30 8.8 >UniRef50_Q4UAB3 Cluster: Putative uncharacterized protein; n=1; Theileria annulata|Rep: Putative uncharacterized protein - Theileria annulata Length = 812 Score = 35.1 bits (77), Expect = 0.31 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = -2 Query: 130 LLTMRHFTKKIVWNKHVNLNNTFTI 56 L+ ++++ KKI+WNK +N NN F + Sbjct: 435 LINLKNWRKKIIWNKKINFNNNFIL 459 >UniRef50_Q8I620 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1066 Score = 31.1 bits (67), Expect = 5.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -2 Query: 136 LLLLTMRHFTKKIVWNKHVNLNNTF--TILLARFQSVAN 26 L LL + FTK+ ++N HVN N + TIL F + N Sbjct: 999 LYLLLIHFFTKQFLYNSHVNTNLDYFNTILFFYFNQIYN 1037 >UniRef50_A5DPY8 Cluster: Putative uncharacterized protein; n=1; Pichia guilliermondii|Rep: Putative uncharacterized protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 345 Score = 30.7 bits (66), Expect = 6.7 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = -2 Query: 199 KSINNTRKHLSVLQLFVVTEPLLLLTMRHFTKKIVWNKHVNLNNTFTIL 53 K +++T+ S++ L T PL++LT+ HF+ I+ VN N F + Sbjct: 109 KDVSSTKLVPSLI-LAAATTPLMILTLAHFSSPILPLGSVNTRNRFDFI 156 >UniRef50_P0A461 Cluster: Modification methylase AvaI (EC 2.1.1.113) (N(4) cytosine-specific methyltransferase AvaI); n=5; Bacteria|Rep: Modification methylase AvaI (EC 2.1.1.113) (N(4) cytosine-specific methyltransferase AvaI) - Anabaena sp. (strain PCC 7120) Length = 482 Score = 30.7 bits (66), Expect = 6.7 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 149 CYRTTTIIDNATLY*KNCLEQTREFEQYFYNFVSTLPKRCER 24 CY T L+ +CL+ EFEQ FY+ + T P C R Sbjct: 271 CYGTQR--SGINLFNASCLKILPEFEQDFYDCIITSPPYCNR 310 >UniRef50_Q4S249 Cluster: Chromosome undetermined SCAF14764, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome undetermined SCAF14764, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1311 Score = 30.3 bits (65), Expect = 8.8 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -2 Query: 148 VTEPLLLLTMRHFTKKIVWNKHVNLNNTFTILLARFQSVANDSNT 14 V +PL + TKK + ++HV L TF L+ + +VA D T Sbjct: 1148 VIQPLQSIPTEKITKKPIPDEHVVLKTTFEGLIQKCLAVATDPQT 1192 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 283,980,770 Number of Sequences: 1657284 Number of extensions: 4433740 Number of successful extensions: 8437 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8436 length of database: 575,637,011 effective HSP length: 88 effective length of database: 429,796,019 effective search space used: 10315104456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -