BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20161 (338 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0923 + 20843477-20845044,20846081-20846996 29 0.93 10_06_0012 - 9586478-9588880 29 1.2 >04_03_0923 + 20843477-20845044,20846081-20846996 Length = 827 Score = 29.1 bits (62), Expect = 0.93 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 130 LLTMRHFTKKIVWNKHVNL--NNTFTILLARFQSVANDSNTS 11 L + H TK I+W+ H N+ +T ILL V S+ S Sbjct: 106 LAILDHATKSIIWSTHANITAKDTIAILLNNGNLVLRSSSNS 147 >10_06_0012 - 9586478-9588880 Length = 800 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 130 LLTMRHFTKKIVWNKHVN--LNNTFTILLARFQSVANDSNTS 11 ++ + TK I+W+ HVN N+T +LL V S+ S Sbjct: 102 MVILDQVTKNIIWSTHVNTRTNHTIVVLLNNGNLVLQSSSNS 143 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,351,419 Number of Sequences: 37544 Number of extensions: 110348 Number of successful extensions: 155 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 470052804 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -