BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fbS20161
(338 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
X06775-2|CAA29943.1| 221|Homo sapiens protein ( Human aberrant ... 28 8.5
>X06775-2|CAA29943.1| 221|Homo sapiens protein ( Human aberrant
mRNA from TRG gamma gene with unrearranged J(g)2
spliced onto C(g)2. ).
Length = 221
Score = 27.9 bits (59), Expect = 8.5
Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
Frame = -3
Query: 267 NTXQXHNDGSTT-P*SXFSQHKNKNLLITXENICLYYSYLLL 145
N + ND +T P +S++ N LL+ N YY YLLL
Sbjct: 152 NYSKDANDVTTMDPKDNWSKNANDTLLLQLTNTSAYYMYLLL 193
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 41,505,054
Number of Sequences: 237096
Number of extensions: 641872
Number of successful extensions: 785
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 781
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 785
length of database: 76,859,062
effective HSP length: 80
effective length of database: 57,891,382
effective search space used: 1852524224
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -