Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20161
         (338 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X06775-2|CAA29943.1|  221|Homo sapiens protein ( Human aberrant ...    28   8.5  

>X06775-2|CAA29943.1|  221|Homo sapiens protein ( Human aberrant
           mRNA from TRG gamma gene with unrearranged J(g)2
           spliced onto C(g)2.  ).
          Length = 221

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = -3

Query: 267 NTXQXHNDGSTT-P*SXFSQHKNKNLLITXENICLYYSYLLL 145
           N  +  ND +T  P   +S++ N  LL+   N   YY YLLL
Sbjct: 152 NYSKDANDVTTMDPKDNWSKNANDTLLLQLTNTSAYYMYLLL 193


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 41,505,054
Number of Sequences: 237096
Number of extensions: 641872
Number of successful extensions: 785
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 781
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 785
length of database: 76,859,062
effective HSP length: 80
effective length of database: 57,891,382
effective search space used: 1852524224
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)