BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20158 (396 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0B7S7 Cluster: Putative transmembrane protein; n=1; Me... 33 2.7 UniRef50_Q8S188 Cluster: Putative uncharacterized protein B1144G... 31 8.1 >UniRef50_A0B7S7 Cluster: Putative transmembrane protein; n=1; Methanosaeta thermophila PT|Rep: Putative transmembrane protein - Methanosaeta thermophila (strain DSM 6194 / PT) (Methanothrixthermophila (strain DSM 6194 / PT)) Length = 387 Score = 32.7 bits (71), Expect = 2.7 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 248 LLLLIH-IKFNLKALTKKYIKVFILCIYSFFSIHLF 352 LLLLI+ IK+N + K + VFIL SF++++LF Sbjct: 103 LLLLINGIKYNYMSFGIKTLHVFILTFISFYAVYLF 138 >UniRef50_Q8S188 Cluster: Putative uncharacterized protein B1144G04.22; n=2; Oryza sativa|Rep: Putative uncharacterized protein B1144G04.22 - Oryza sativa subsp. japonica (Rice) Length = 967 Score = 31.1 bits (67), Expect = 8.1 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 372 HKVATXPNKWIEKNE*IHRIKTFIYFFVSAFKLNLIWISSKS 247 H + + W+E NE + R+ T I F + L L+W S +S Sbjct: 722 HYIPISADGWLELNEVMLRVPTLIAFALHLCLLQLVWSSRRS 763 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 319,499,696 Number of Sequences: 1657284 Number of extensions: 5185523 Number of successful extensions: 10149 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10142 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 16503508437 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -