BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20158 (396 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC062325-1|AAH62325.1| 424|Homo sapiens USP34 protein protein. 29 5.6 BC022783-1|AAH22783.1| 986|Homo sapiens USP34 protein protein. 29 5.6 AJ586138-1|CAE51938.1| 3395|Homo sapiens ubiquitin-specific prot... 29 5.6 AB018272-1|BAA34449.1| 1196|Homo sapiens KIAA0729 protein protein. 29 5.6 AB011142-1|BAA25496.2| 3412|Homo sapiens KIAA0570 protein protein. 29 5.6 >BC062325-1|AAH62325.1| 424|Homo sapiens USP34 protein protein. Length = 424 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +2 Query: 230 YGYHYVLLLLIHIKFNLKALTKKYIKVFILCIYSFFSIHL 349 + YH + LL + N + T+ +K+ +L Y +HL Sbjct: 21 FSYHQFIHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHL 60 >BC022783-1|AAH22783.1| 986|Homo sapiens USP34 protein protein. Length = 986 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +2 Query: 230 YGYHYVLLLLIHIKFNLKALTKKYIKVFILCIYSFFSIHL 349 + YH + LL + N + T+ +K+ +L Y +HL Sbjct: 583 FSYHQFIHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHL 622 >AJ586138-1|CAE51938.1| 3395|Homo sapiens ubiquitin-specific proteinase 34 protein. Length = 3395 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +2 Query: 230 YGYHYVLLLLIHIKFNLKALTKKYIKVFILCIYSFFSIHL 349 + YH + LL + N + T+ +K+ +L Y +HL Sbjct: 2992 FSYHQFIHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHL 3031 >AB018272-1|BAA34449.1| 1196|Homo sapiens KIAA0729 protein protein. Length = 1196 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +2 Query: 230 YGYHYVLLLLIHIKFNLKALTKKYIKVFILCIYSFFSIHL 349 + YH + LL + N + T+ +K+ +L Y +HL Sbjct: 793 FSYHQFIHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHL 832 >AB011142-1|BAA25496.2| 3412|Homo sapiens KIAA0570 protein protein. Length = 3412 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +2 Query: 230 YGYHYVLLLLIHIKFNLKALTKKYIKVFILCIYSFFSIHL 349 + YH + LL + N + T+ +K+ +L Y +HL Sbjct: 3009 FSYHQFIHLLCRVAINCEKFTETLVKLSVLVAYEGLPLHL 3048 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,898,556 Number of Sequences: 237096 Number of extensions: 776007 Number of successful extensions: 954 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 954 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2813442310 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -