BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20156 (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 30 0.010 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 25 0.50 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 25 0.50 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 24 0.67 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 24 0.67 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 0.88 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 1.5 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 1.5 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 23 1.5 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 2.0 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 2.7 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 3.6 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 3.6 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 3.6 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 3.6 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 3.6 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 3.6 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 3.6 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 3.6 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 3.6 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 3.6 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 3.6 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 3.6 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 22 3.6 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 22 3.6 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 22 3.6 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 22 3.6 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 3.6 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 3.6 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 3.6 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 4.7 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 4.7 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 4.7 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 4.7 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 4.7 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 4.7 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 4.7 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 4.7 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 21 4.7 AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin prot... 21 4.7 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 21 4.7 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 6.2 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 6.2 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 6.2 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 6.2 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 6.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 6.2 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 8.2 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 8.2 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 8.2 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 8.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 8.2 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 30.3 bits (65), Expect = 0.010 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +2 Query: 2 QKGDRGLPGLQGLQGEKGDRGSLGEKGDQGFTGRMG 109 Q+G +G+ QG+QG +G +G G +G QG G G Sbjct: 841 QQGVQGVQTAQGVQGVQGVQGVQGVQGVQGVQGVPG 876 Score = 27.9 bits (59), Expect = 0.054 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 26 GLQGLQGEKGDRGSLGEKGDQGFTGRMGEKG 118 G+QG+Q +G +G G +G QG G G +G Sbjct: 843 GVQGVQTAQGVQGVQGVQGVQGVQGVQGVQG 873 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 5 KGDRGLPGLQGLQGEKGDRGSL 70 +G +G+ G+QG+QG +G G L Sbjct: 857 QGVQGVQGVQGVQGVQGVPGLL 878 Score = 23.8 bits (49), Expect = 0.88 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 164 KGEKGLPGTHGKHGRPGLPGAPGQKGDQGLQ 256 +G +G+ G G G PGL Q QG+Q Sbjct: 860 QGVQGVQGVQGVQGVPGLLQGVQQVFGQGVQ 890 Score = 22.6 bits (46), Expect = 2.0 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 5 KGDRGLPGLQGLQGEKGDRGSLGEKGDQGFTG 100 +G +G+ G+QG+QG G + + QG G Sbjct: 860 QGVQGVQGVQGVQGVPGLLQGVQQVFGQGVQG 891 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 24.6 bits (51), Expect = 0.50 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + + R+K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEKEYRKYRERSKERSR 68 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 24.6 bits (51), Expect = 0.50 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + + R+K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEKEYRKYRERSKERSR 68 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 24.2 bits (50), Expect = 0.67 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + R+K RSR Sbjct: 266 RTSRKRYSRSREREQNSYKNEREYRKYRERSKERSR 301 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 24.2 bits (50), Expect = 0.67 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 245 QGLQDFRDNWVGLVYLGSQVKKD 313 +G + DNW ++YLG+ V D Sbjct: 307 KGQMIYMDNWKMMMYLGTPVMPD 329 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.8 bits (49), Expect = 0.88 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = -3 Query: 252 RP*SPFCPGAPGNPGLPCFP*-VPGKPFSPFIVKPGRPVGPIGPVSPFSPIRPVKP 88 +P S G+PG+ G+ V +P + G + PVSP+ ++P+ P Sbjct: 278 KPNSTTMNGSPGSGGIRSDQMGVKIEPAEAESLSTSGSSGILTPVSPYGYVKPISP 333 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 1.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 209 PGLPGAPGQKGD 244 PG PG PG GD Sbjct: 332 PGPPGVPGDHGD 343 Score = 22.6 bits (46), Expect = 2.0 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 280 PGIPGLPGEKGQKGDQGNE 336 PG PG+PG+ G + E Sbjct: 332 PGPPGVPGDHGDHAPKQTE 350 Score = 21.8 bits (44), Expect = 3.6 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 167 GEKGLPGTHGKH 202 G G+PG HG H Sbjct: 333 GPPGVPGDHGDH 344 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 1.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 209 PGLPGAPGQKGD 244 PG PG PG GD Sbjct: 332 PGPPGVPGDHGD 343 Score = 22.6 bits (46), Expect = 2.0 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 280 PGIPGLPGEKGQKGDQGNE 336 PG PG+PG+ G + E Sbjct: 332 PGPPGVPGDHGDHAPKQTE 350 Score = 21.8 bits (44), Expect = 3.6 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 167 GEKGLPGTHGKH 202 G G+PG HG H Sbjct: 333 GPPGVPGDHGDH 344 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 23.0 bits (47), Expect = 1.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 209 PGLPGAPGQKGD 244 PG PG PG GD Sbjct: 271 PGPPGVPGDHGD 282 Score = 21.8 bits (44), Expect = 3.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 280 PGIPGLPGEKG 312 PG PG+PG+ G Sbjct: 271 PGPPGVPGDHG 281 Score = 21.8 bits (44), Expect = 3.6 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 167 GEKGLPGTHGKH 202 G G+PG HG H Sbjct: 272 GPPGVPGDHGDH 283 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 22.6 bits (46), Expect = 2.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 170 EKGLPGTHGKHGRPGL 217 + GL G HG HG GL Sbjct: 131 QTGLHGLHGLHGLHGL 146 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 167 GEKGLPGTHGKHG 205 G GL G HG HG Sbjct: 133 GLHGLHGLHGLHG 145 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 185 GTHGKHGRPGLPG 223 G HG HG GL G Sbjct: 133 GLHGLHGLHGLHG 145 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEKEYRKYRETSKERSR 68 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 68 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + + S+K + R+K RSR Sbjct: 33 RTSRKRYSRSREREQKSYKNERKYRKYRERSKERSR 68 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + + S+K + R+K RSR Sbjct: 33 RTSRKRYSRSREREQKSYKNERKYRKYRERSKERSR 68 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 3.6 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 255 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERSR 290 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERSR 68 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERSR 68 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERSR 68 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERSR 68 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERSR 68 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERSR 68 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERSR 68 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.4 bits (43), Expect = 4.7 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 185 GTHGKHGRPGLPG 223 G H HG PG+ G Sbjct: 330 GVHNLHGMPGILG 342 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 21.4 bits (43), Expect = 4.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 93 LLGEWEKKVTL 125 LLGEWEK+ + Sbjct: 174 LLGEWEKRAPM 184 >AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin protein. Length = 215 Score = 21.4 bits (43), Expect = 4.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 93 LLGEWEKKVTL 125 LLGEWEK+ + Sbjct: 174 LLGEWEKRAPM 184 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 21.4 bits (43), Expect = 4.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 93 LLGEWEKKVTL 125 LLGEWEK+ + Sbjct: 174 LLGEWEKRAPM 184 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 6.2 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 255 RTSRKRYSRSREREQNSYKNEREYRKYRETSKGRSR 290 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 6.2 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + +NS+K + +K RSR Sbjct: 266 RTSRKRYSRSREREQNSYKNEREYRKYRETSKGRSR 301 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 6.2 Identities = 5/12 (41%), Positives = 6/12 (50%) Frame = +3 Query: 357 SCRSNWTTWNSW 392 S +W WN W Sbjct: 691 SVNKSWNKWNDW 702 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 6.2 Identities = 5/12 (41%), Positives = 6/12 (50%) Frame = +3 Query: 357 SCRSNWTTWNSW 392 S +W WN W Sbjct: 691 SVNKSWNKWNDW 702 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.0 bits (42), Expect = 6.2 Identities = 5/12 (41%), Positives = 6/12 (50%) Frame = +3 Query: 357 SCRSNWTTWNSW 392 S +W WN W Sbjct: 691 SVNKSWNKWNDW 702 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.0 bits (42), Expect = 6.2 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +1 Query: 271 LGRPGIPGLPGEKGQ 315 +G P P +P E+G+ Sbjct: 45 VGTPAAPNMPAEEGE 59 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 8.2 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + + S+K + + +K RSR Sbjct: 33 RTSRKRYSRSREREKKSYKNENSYRKYRETSKERSR 68 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 8.2 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + + S+K + + +K RSR Sbjct: 33 RTSRKRYSRSREREKKSYKNENSYRKYRETSKERSR 68 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 20.6 bits (41), Expect = 8.2 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + + S+K + + +K RSR Sbjct: 33 RTSRKRYSRSREREKKSYKNENSYRKYRETSKERSR 68 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 8.2 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + + S+K + + +K RSR Sbjct: 33 RTSRKRYSRSREREKKSYKNENSYRKYRETSKERSR 68 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 20.6 bits (41), Expect = 8.2 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 142 RPTRLNYKRRKRLTRNSWKTWEARITWCSRTKRRSR 249 R +R Y R + + S+K + + +K RSR Sbjct: 266 RTSRKRYSRSREREKKSYKNENSYRKYRETSKERSR 301 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,265 Number of Sequences: 438 Number of extensions: 2902 Number of successful extensions: 91 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -