BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20155 (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 26 0.25 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 3.1 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 4.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.1 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 5.4 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 5.4 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 21 5.4 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 5.4 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 5.4 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 21 5.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 5.4 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 7.1 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 9.4 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 9.4 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.4 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.4 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 25.8 bits (54), Expect = 0.25 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +3 Query: 366 CTASPPCSPRTLVLRSTTPTPRRWLRWPDSTSPEKNK 476 C A+ P + + P RW+ P S E+NK Sbjct: 689 CVAANPAAEVRYTAKLQVKVPPRWIVEPTDVSVERNK 725 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +3 Query: 336 PILRPYPGKGCTASPPCSPRTLVLR 410 P+L PYP + CS T V R Sbjct: 103 PLLEPYPNWSWAKNQNCSGITSVYR 127 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -1 Query: 265 PGAIFWQRSSPLTPTTQSGDGP 200 P WQR+ L T DGP Sbjct: 440 PSTTLWQRAHRLGIDTPKKDGP 461 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +3 Query: 408 RSTTPTPRRWLRWPDSTSPEKNK 476 R P RW+ P S E+NK Sbjct: 699 RLVVHVPPRWIVEPTDVSVERNK 721 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 5.4 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +3 Query: 177 YLSLASMFGPSPDWVVGVSGLDLCQKIAPGLN 272 Y L S+FG W + + D I GL+ Sbjct: 128 YAMLGSLFGCGSIWTMTMIAFDRYNVIVKGLS 159 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 350 VPRERMYRITPMFPEDPRAPFYDPD 424 +PRE RIT F + F+D + Sbjct: 404 LPREMRQRITEYFEHRYQGKFFDEE 428 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 21.4 bits (43), Expect = 5.4 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +3 Query: 177 YLSLASMFGPSPDWVVGVSGLDLCQKIAPGLN 272 Y L S+FG W + + D I GL+ Sbjct: 94 YAMLGSLFGCGSIWTMTMIAFDRYNVIVKGLS 125 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 5.4 Identities = 16/57 (28%), Positives = 21/57 (36%) Frame = +3 Query: 210 PDWVVGVSGLDLCQKIAPGLNLRLSTCILTTLAQTMASLTCRPILRPYPGKGCTASP 380 P +GV LD C + LN L + M+ L C P K +A P Sbjct: 13 PGITIGVHILDTCGRDTYALNQSLHFVRASLSNLDMSVLECADRSAPRVKKTASAGP 69 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 350 VPRERMYRITPMFPEDPRAPFYDPD 424 +PRE RIT F + F+D + Sbjct: 372 LPREMRQRITEYFEHRYQGKFFDEE 396 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 21.4 bits (43), Expect = 5.4 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +3 Query: 177 YLSLASMFGPSPDWVVGVSGLDLCQKIAPGLN 272 Y L S+FG W + + D I GL+ Sbjct: 4 YAMLGSLFGCGSIWTMTMIAFDRYNVIVKGLS 35 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 5.4 Identities = 16/57 (28%), Positives = 21/57 (36%) Frame = +3 Query: 210 PDWVVGVSGLDLCQKIAPGLNLRLSTCILTTLAQTMASLTCRPILRPYPGKGCTASP 380 P +GV LD C + LN L + M+ L C P K +A P Sbjct: 103 PGITIGVHILDTCGRDTYALNQSLHFVRASLSNLDMSVLECADRSAPRVKKTASAGP 159 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.0 bits (42), Expect = 7.1 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +1 Query: 373 HHPHVPRGPSCSV 411 HHPH P P V Sbjct: 465 HHPHPPETPGPQV 477 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +3 Query: 336 PILRPYPGKGCTASPPCS 389 P+LRPYP CS Sbjct: 108 PLLRPYPDWSFAKYEDCS 125 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 194 YVWSIS*LGGGSEWTGPLPE 253 Y+ + +GG EWTG + E Sbjct: 491 YIIKNNSVGGKKEWTGLIGE 510 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 20.6 bits (41), Expect = 9.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 399 LVLRSTTPTPRRWLRW 446 L L+ST TPR L W Sbjct: 120 LFLKSTEVTPRDGLGW 135 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = +2 Query: 335 PNSETVPRERMYRITPMFPEDPRAPFY 415 P+++ VP+ + P P P P Y Sbjct: 768 PSAQNVPQNTNSQAIPRIPILPMIPVY 794 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,851 Number of Sequences: 438 Number of extensions: 4064 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -