Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20152
         (354 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00004EBBCF Cluster: Hypothetical protein MuHV1gpm20;...    31   7.5  

>UniRef50_UPI00004EBBCF Cluster: Hypothetical protein MuHV1gpm20;
           n=1; Murid herpesvirus 1|Rep: Hypothetical protein
           MuHV1gpm20 - Murid herpesvirus 1
          Length = 747

 Score = 30.7 bits (66), Expect = 7.5
 Identities = 15/41 (36%), Positives = 18/41 (43%)
 Frame = +3

Query: 153 PPLARSFLRFTAQSPXSPHTPRYDXRRGHATITDKMMTTFL 275
           PP  R F R T+ +P  P+   YD      T  D    TFL
Sbjct: 393 PPGGRGFKRCTSTTPDEPNASFYDAEEALTTYQDSGSETFL 433


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.305    0.120    0.333 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 134,837,490
Number of Sequences: 1657284
Number of extensions: 942616
Number of successful extensions: 1261
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1246
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1261
length of database: 575,637,011
effective HSP length: 90
effective length of database: 426,481,451
effective search space used: 11514999177
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 43 (22.0 bits)