BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20151 (356 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 1.5 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 24 2.0 AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical prote... 23 3.4 AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory a... 23 3.4 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 22 7.9 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 24.2 bits (50), Expect = 1.5 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -3 Query: 156 VVVAGEDAVVQFLL-EVLVRSVRG*FNDARADGEHAH 49 ++VA + V L+ + V RG FNDA+AD AH Sbjct: 85 LIVADPELVKSILVKDFSVFHDRGVFNDAKADPLSAH 121 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -1 Query: 242 LSMIXLLTTFWMMEPLPWLSYS 177 L+++ +LT +W M LP+L S Sbjct: 97 LTLVEILTKYWPMGRLPFLCKS 118 >AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical protein protein. Length = 127 Score = 23.0 bits (47), Expect = 3.4 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 25 MKLLEEFAMCMLAVSAGVVELSADTSNQDLEEKLYNSILTGDY 153 MKL A +LA++A + + DL+E L + L +Y Sbjct: 1 MKLFVAIAFALLALAAAQEQYTTKYDGIDLDEILKSDRLFNNY 43 >AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory appendage protein SAP-2 protein. Length = 127 Score = 23.0 bits (47), Expect = 3.4 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +1 Query: 25 MKLLEEFAMCMLAVSAGVVELSADTSNQDLEEKLYNSILTGDY 153 MKL A +LA++A + + DL+E L + L +Y Sbjct: 1 MKLFVAIAFALLALAAAQEQYTTKYDGIDLDEILKSDRLFNNY 43 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 21.8 bits (44), Expect = 7.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 105 PRPRGETVQQHPHRRLRQ 158 P P + QQH H L+Q Sbjct: 775 PSPNQQQQQQHHHHHLQQ 792 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 337,365 Number of Sequences: 2352 Number of extensions: 5975 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26224815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -