BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20151 (356 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69390.1 68414.m07966 chloroplast division protein, putative ... 29 0.91 At5g32070.1 68418.m03689 hypothetical protein 29 1.2 At5g47050.1 68418.m05798 expressed protein 28 2.1 At4g15480.1 68417.m02366 UDP-glucoronosyl/UDP-glucosyl transfera... 27 4.9 At3g47890.1 68416.m05222 ubiquitin carboxyl-terminal hydrolase-r... 27 4.9 At4g34790.1 68417.m04938 auxin-responsive family protein similar... 26 6.4 At4g25650.2 68417.m03694 Rieske [2Fe-2S] domain-containing prote... 26 8.5 At4g25650.1 68417.m03693 Rieske [2Fe-2S] domain-containing prote... 26 8.5 At2g30530.1 68415.m03718 expressed protein 26 8.5 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.1 bits (62), Expect = 0.91 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 55 MLAVSAGVVELSADTSNQDLEEKLYNSILTGDYD 156 +LA + G ELS + Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSPSPAEQEIESFLYNAINMGFFD 103 >At5g32070.1 68418.m03689 hypothetical protein Length = 339 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/51 (29%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Frame = +1 Query: 28 KLLEEFAMCMLAVSAGV--VELSADTSNQDLEEKLYNSILTGDYDSAVRQS 174 K +++F+ +LA+ G + LSAD+ + + L NS++T D+ ++++ S Sbjct: 142 KEIQQFSDWLLAIGDGEERIYLSADSIDPTDSDSLANSVITPDFLNSIKLS 192 >At5g47050.1 68418.m05798 expressed protein Length = 300 Score = 27.9 bits (59), Expect = 2.1 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Frame = +2 Query: 8 ERLLTK*NSSKNLR---CACSPSARASLNYPRTLLTKTSRRNCTTASSPATTTVLSGRAW 178 +R+L + NS +N R S R L + K +RR+ + AT RAW Sbjct: 129 KRMLAE-NSERNYRELLRTTEESVRRRLREKEAEIEKATRRH-VELEARATQIETEARAW 186 Query: 179 NMRAKAR 199 MRA AR Sbjct: 187 QMRAAAR 193 >At4g15480.1 68417.m02366 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 490 Score = 26.6 bits (56), Expect = 4.9 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 297 FPVRCRPTACSSTPCVPSLVNDXVVNYI 214 FP P PCVP L ND + +++ Sbjct: 174 FPTETEPELDVKLPCVPVLKNDEIPSFL 201 >At3g47890.1 68416.m05222 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1568 Score = 26.6 bits (56), Expect = 4.9 Identities = 12/49 (24%), Positives = 24/49 (48%) Frame = +1 Query: 58 LAVSAGVVELSADTSNQDLEEKLYNSILTGDYDSAVRQSLEYESQGKGS 204 +A+ AGV + + +K N ++ G Y + +S + +SQ G+ Sbjct: 1099 IAIQAGVFQSDQRPGRRGRRQKASNKLVDGKYQVTLSESEDSKSQRSGT 1147 >At4g34790.1 68417.m04938 auxin-responsive family protein similar to auxin-induced protein X10A (SP:P33080) [Glycine max.] PIR:JQ1099 Length = 108 Score = 26.2 bits (55), Expect = 6.4 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 71 RASLNYPRTLLTKTSRRNCTTASSPATTTVLSG 169 R+ L + + S RN +SSP+TTT SG Sbjct: 5 RSMLPNAKQIFKSQSMRNKNGSSSPSTTTTTSG 37 >At4g25650.2 68417.m03694 Rieske [2Fe-2S] domain-containing protein similar to cell death suppressor protein lls1 from Zea mays [gi:1935909], Rieske iron-sulfur protein Tic55 from Pisum sativum [gi:2764524]; contains Pfam PF00355 Rieske [2Fe-2S] domain Length = 559 Score = 25.8 bits (54), Expect = 8.5 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 29 NSSKNLRCACS-PSARASLNYPRTLLTKTSRRNCTTASSPATTT 157 N+ RC+ S PS S P +L+T+ S R T SSP +++ Sbjct: 17 NTKPRFRCSFSNPSLPIS---PNSLITRKSSRFTTAVSSPPSSS 57 >At4g25650.1 68417.m03693 Rieske [2Fe-2S] domain-containing protein similar to cell death suppressor protein lls1 from Zea mays [gi:1935909], Rieske iron-sulfur protein Tic55 from Pisum sativum [gi:2764524]; contains Pfam PF00355 Rieske [2Fe-2S] domain Length = 536 Score = 25.8 bits (54), Expect = 8.5 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 29 NSSKNLRCACS-PSARASLNYPRTLLTKTSRRNCTTASSPATTT 157 N+ RC+ S PS S P +L+T+ S R T SSP +++ Sbjct: 17 NTKPRFRCSFSNPSLPIS---PNSLITRKSSRFTTAVSSPPSSS 57 >At2g30530.1 68415.m03718 expressed protein Length = 371 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +2 Query: 98 LLTKTSRRNCTTASSPATTTVLSGRAWNMRAKA 196 ++T T+R + +++SSP+ ++ S A ++ AKA Sbjct: 26 MMTPTTRMSYSSSSSPSPSSASSSAASSLAAKA 58 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,051,818 Number of Sequences: 28952 Number of extensions: 124267 Number of successful extensions: 288 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 288 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 459356736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -