BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20150 (457 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL590551-1|CAH71650.1| 600|Homo sapiens fibronectin type III do... 29 5.7 AF225404-1|AAO27482.1| 259|Homo sapiens HERC2 protein. 29 10.0 AF071172-1|AAD08657.1| 4834|Homo sapiens HERC2 protein. 29 10.0 >AL590551-1|CAH71650.1| 600|Homo sapiens fibronectin type III domain containing 1 protein. Length = 600 Score = 29.5 bits (63), Expect = 5.7 Identities = 25/92 (27%), Positives = 35/92 (38%) Frame = +3 Query: 24 KPFKLFCVFSXRXYMPTEPQSPTPNSKTIFTTASSLPITTMPLKKANRSTRTRRAKSSQM 203 KP V + PT PT + + TT + P T R+T TRR + + Sbjct: 138 KPLVGLEVIKKTTHPPTTTMQPTTTTTPLPTTTTPRPTTA----TTRRTTTTRRTTTRRP 193 Query: 204 S*TNSYETTR*TAWSTPPALDARLQGYRPGVL 299 T + TT T +T P + PG L Sbjct: 194 --TTTVRTTTRTTTTTTPTPTTPIPTCPPGTL 223 >AF225404-1|AAO27482.1| 259|Homo sapiens HERC2 protein. Length = 259 Score = 28.7 bits (61), Expect = 10.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 335 LFSAKISVNSTGKHSRTISLEPCIQSW 255 +F K++VNS GKH +S E + SW Sbjct: 212 VFIKKVAVNSGGKHCLALSSEGEVYSW 238 >AF071172-1|AAD08657.1| 4834|Homo sapiens HERC2 protein. Length = 4834 Score = 28.7 bits (61), Expect = 10.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 335 LFSAKISVNSTGKHSRTISLEPCIQSW 255 +F K++VNS GKH +S E + SW Sbjct: 4037 VFIKKVAVNSGGKHCLALSSEGEVYSW 4063 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,993,706 Number of Sequences: 237096 Number of extensions: 925776 Number of successful extensions: 3153 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3153 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3815180866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -