BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20143 (621 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0061 + 815761-816117,817298-818002 29 2.3 01_06_1703 + 39301075-39301829,39302735-39303560 28 6.9 01_01_0216 + 1843413-1843509,1844583-1844694,1844841-1844908,184... 28 6.9 01_03_0149 + 13194866-13195012,13196576-13196828,13197810-131981... 27 9.1 >10_01_0061 + 815761-816117,817298-818002 Length = 353 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/22 (59%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = +1 Query: 517 LTPIPSAYLADKF-GRKTTLLL 579 LTP+ A++AD F GR+TT+LL Sbjct: 91 LTPLVGAFIADSFLGRRTTILL 112 >01_06_1703 + 39301075-39301829,39302735-39303560 Length = 526 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 487 DSLNNDTRSALTPIPSAYLADKF-GRKTTLLL 579 D N ++TP+ +AYLAD F GR T+LL Sbjct: 38 DVTNWQGTGSITPLVAAYLADAFLGRYWTILL 69 >01_01_0216 + 1843413-1843509,1844583-1844694,1844841-1844908, 1845165-1845297,1845404-1845503,1845562-1845722, 1846095-1846188,1846273-1846426,1846597-1846743, 1846819-1846892,1846985-1847073,1847161-1847275, 1847569-1847751 Length = 508 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +1 Query: 541 LADKFGRKTTLLLGAIP 591 LADKFGR T +L AIP Sbjct: 113 LADKFGRTRTFILDAIP 129 >01_03_0149 + 13194866-13195012,13196576-13196828,13197810-13198173, 13198283-13198501,13199888-13200002,13200697-13200948, 13201149-13201442 Length = 547 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -2 Query: 377 SHIMLFHIPSNVNEFLLPFCCININIFTLLY 285 ++I ++ I + NE +L F +N N+ LLY Sbjct: 216 NYIPIYEIEATRNETILEFAKLNFNLLQLLY 246 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,507,230 Number of Sequences: 37544 Number of extensions: 231285 Number of successful extensions: 501 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -