BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20143 (621 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 1.8 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 22 4.2 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 22 4.2 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 22 4.2 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 22 4.2 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 4.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 4.2 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 4.2 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 4.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.3 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 9.7 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +1 Query: 298 NIFILIQQNGSKNSFTLEGIWNSIMCDPHYCNSRYLLRL 414 +I Q +K+S+T+ G+ +I H+C Y +++ Sbjct: 433 SIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKV 471 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 Query: 521 HRFHPPISP 547 +RFHPP++P Sbjct: 160 YRFHPPLNP 168 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 Query: 521 HRFHPPISP 547 +RFHPP++P Sbjct: 160 YRFHPPLNP 168 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 Query: 521 HRFHPPISP 547 +RFHPP++P Sbjct: 160 YRFHPPLNP 168 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 Query: 521 HRFHPPISP 547 +RFHPP++P Sbjct: 160 YRFHPPLNP 168 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 Query: 521 HRFHPPISP 547 +RFHPP++P Sbjct: 164 YRFHPPLNP 172 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 Query: 521 HRFHPPISP 547 +RFHPP++P Sbjct: 169 YRFHPPLNP 177 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 Query: 521 HRFHPPISP 547 +RFHPP++P Sbjct: 169 YRFHPPLNP 177 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 Query: 521 HRFHPPISP 547 +RFHPP++P Sbjct: 169 YRFHPPLNP 177 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 530 HPPISPTNSEEKLH 571 +P I+P N EKLH Sbjct: 1474 YPRINPDNHNEKLH 1487 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 513 GSNTDSIRLSRRQIRKKNYTASRSYPFIIG 602 G ++D IRL R++ + PF+IG Sbjct: 381 GLDSDGIRLPCREVEAAATARNVVAPFLIG 410 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.0 bits (42), Expect = 9.7 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -2 Query: 278 YCAIWNE 258 YCA WNE Sbjct: 573 YCAFWNE 579 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,436 Number of Sequences: 438 Number of extensions: 3121 Number of successful extensions: 12 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -