BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20141 (536 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 24 0.98 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 3.0 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 6.9 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 21 9.1 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 23.8 bits (49), Expect = 0.98 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +2 Query: 173 REG*DRRCSFALPHQKASIQRSHLRPELLEELEAFTKLGPDFTAEIRHAGILSFASLLHK 352 +EG + + A+P K +Q + PEL E L+A + D AG S L+K Sbjct: 175 KEGKNWEITMAVPIAKFRLQEGYHVPELCELLDAIHVMSYDLRG--NWAGFADSHSPLYK 232 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.2 bits (45), Expect = 3.0 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -1 Query: 272 PPALRATLVEGGYVEWKLSDEGEQS 198 PP L V G+ WK S +G S Sbjct: 52 PPPLADAAVGKGFHPWKKSPQGAPS 76 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.0 bits (42), Expect = 6.9 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 356 LSYAASWRNSRSRRGVFPP*N 294 L + ASW R+ G F P N Sbjct: 27 LCFFASWAGYRNGEGSFKPQN 47 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 20.6 bits (41), Expect = 9.1 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 260 EELEAFTKLGPDFTAEIRHAGILSFASLL 346 E E FT L + RH G+L S+L Sbjct: 184 EHKEQFTALVREIRNAFRHDGLLLTMSVL 212 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,588 Number of Sequences: 336 Number of extensions: 3197 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13097125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -