BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20141 (536 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g23140.1 68415.m02763 armadillo/beta-catenin repeat family pr... 29 1.5 At4g00160.1 68417.m00016 F-box family protein contains F-box dom... 29 2.0 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 29 2.0 At5g17670.1 68418.m02071 expressed protein 28 3.4 At5g16290.2 68418.m01904 acetolactate synthase small subunit, pu... 28 3.4 At5g16290.1 68418.m01903 acetolactate synthase small subunit, pu... 28 3.4 At4g15140.1 68417.m02325 expressed protein 28 3.4 At2g31810.3 68415.m03885 acetolactate synthase small subunit, pu... 28 3.4 At2g31810.2 68415.m03884 acetolactate synthase small subunit, pu... 28 3.4 At2g31810.1 68415.m03883 acetolactate synthase small subunit, pu... 28 3.4 At4g36380.1 68417.m05169 cytochrome P450 90C1 (CYP90C1) / rotund... 27 7.9 At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative simi... 27 7.9 At3g01780.1 68416.m00118 expressed protein est hit, 27 7.9 At2g37585.1 68415.m04611 glycosyltransferase family 14 protein /... 27 7.9 >At2g23140.1 68415.m02763 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 811 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +3 Query: 24 LNYTTIIKLFEDLVLGTSYDMETSRNIFLEALPHARSEACARFIKYLVIEEKDKIEDAAL 203 L +++ D ++ T + +S+N + L A E C IK+L EE + D AL Sbjct: 89 LQIESLLPKMRDTIVDTFQFLMSSKNHLPDELSPASLEQCLEKIKHLSYEEISSVIDGAL 148 >At4g00160.1 68417.m00016 F-box family protein contains F-box domain Pfam:PF00646 Length = 453 Score = 29.1 bits (62), Expect = 2.0 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +3 Query: 153 IKYLVIEEKDKIE---DAALLSLIRKLPFNVATFDQSCSKSWRPL 278 ++ V+ KD+I DA L+ ++ LP + SK WRPL Sbjct: 7 LRIRVVMGKDRISELPDALLIKILSFLPTKIVVATSVFSKQWRPL 51 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 29.1 bits (62), Expect = 2.0 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +2 Query: 56 RPGPRHQLRHGDIQEYLPGGAPSCQERGLR*VHQ 157 R GP+H HG+ Y PG PS Q L HQ Sbjct: 458 RNGPKH---HGETMRYTPGPLPSFQITDLNQKHQ 488 >At5g17670.1 68418.m02071 expressed protein Length = 309 Score = 28.3 bits (60), Expect = 3.4 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 407 YFRMYSDCPQYLDRMVWLQGLCNIGYSAEGYL-RIFM 514 Y D + + + QGLC IG+SA G+L R++M Sbjct: 98 YLNRIDDAVREANELAQGQGLCLIGHSAGGWLARVYM 134 >At5g16290.2 68418.m01904 acetolactate synthase small subunit, putative similar to gi:5931761 from Nicotiana plumbaginifolia Length = 477 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 161 VLDEPSAGLAPGMRERLQEDIPGCLHVVTGA 69 V DE S+GL L ++PG L+++TGA Sbjct: 297 VYDEDSSGLRSHTLSLLVANVPGVLNLITGA 327 >At5g16290.1 68418.m01903 acetolactate synthase small subunit, putative similar to gi:5931761 from Nicotiana plumbaginifolia Length = 477 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 161 VLDEPSAGLAPGMRERLQEDIPGCLHVVTGA 69 V DE S+GL L ++PG L+++TGA Sbjct: 297 VYDEDSSGLRSHTLSLLVANVPGVLNLITGA 327 >At4g15140.1 68417.m02325 expressed protein Length = 138 Score = 28.3 bits (60), Expect = 3.4 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +3 Query: 210 LIRKLPFNVAT-FDQSCSKSWRPLPS*ARILRRKYATPGS*VSPACCIRQL 359 L+ K P N A FD S S W PL L R YA+P S +C R L Sbjct: 36 LLCKFPDNSAFGFDYSQSSLWSPL------LPRNYASPSDLDSDSCVCRNL 80 >At2g31810.3 68415.m03885 acetolactate synthase small subunit, putative similar to gi:5931761 from Nicotiana plumbaginifolia Length = 469 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 155 DEPSAGLAPGMRERLQEDIPGCLHVVTG 72 DE ++GL L DIPG L++VTG Sbjct: 311 DEDTSGLRSHTLSLLVNDIPGVLNIVTG 338 >At2g31810.2 68415.m03884 acetolactate synthase small subunit, putative similar to gi:5931761 from Nicotiana plumbaginifolia Length = 492 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 155 DEPSAGLAPGMRERLQEDIPGCLHVVTG 72 DE ++GL L DIPG L++VTG Sbjct: 311 DEDTSGLRSHTLSLLVNDIPGVLNIVTG 338 >At2g31810.1 68415.m03883 acetolactate synthase small subunit, putative similar to gi:5931761 from Nicotiana plumbaginifolia Length = 491 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 155 DEPSAGLAPGMRERLQEDIPGCLHVVTG 72 DE ++GL L DIPG L++VTG Sbjct: 311 DEDTSGLRSHTLSLLVNDIPGVLNIVTG 338 >At4g36380.1 68417.m05169 cytochrome P450 90C1 (CYP90C1) / rotundifolia3 (ROT3) identical to Cytochrome P450 90C1 (ROTUNDIFOLIA3) (SP:Q9M066) [Arabidopsis thaliana]; Length = 524 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 156 KYLVIEEKDKIEDAALLSLIRKLPFNVATFDQSCS 260 +Y E+D+I + + R+LP VAT D S S Sbjct: 483 RYSWTAEEDEIVSFPTVKMKRRLPIRVATVDDSAS 517 >At4g12570.1 68417.m01983 ubiquitin-protein ligase, putative similar to SP|P39940 Ubiquitin--protein ligase RSP5 (EC 6.3.2.-) {Saccharomyces cerevisiae}; contains Pfam profiles PF00240: Ubiquitin family, PF00632: HECT-domain (ubiquitin-transferase) Length = 873 Score = 27.1 bits (57), Expect = 7.9 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 2/73 (2%) Frame = +2 Query: 302 AEIRHAGILSFASLLHKTIEFSL--IKQDYIDNVVVKYFRMYSDCPQYLDRMVWLQGLCN 475 AEIRH L F SLL T++ + ++ D V M S QYL + + + N Sbjct: 386 AEIRHLHRL-FGSLL-TTMDLCMCRVESSLADKEVGNSETMSSSWSQYLSILKIINSMSN 443 Query: 476 IGYSAEGYLRIFM 514 I A+G L + + Sbjct: 444 IYQGAKGQLAVML 456 >At3g01780.1 68416.m00118 expressed protein est hit, Length = 1176 Score = 27.1 bits (57), Expect = 7.9 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 33 TTIIKLFEDLVLGTSYDMETSRNIFLEALPHARSEAC 143 T II LFED + + TS+++F E L E+C Sbjct: 430 TDIISLFEDARIKDDLNSVTSKSLFREELVAMLVESC 466 >At2g37585.1 68415.m04611 glycosyltransferase family 14 protein / core-2/I-branching enzyme family protein contains Pfam profile: PF02485 Core-2/I-Branching enzyme Length = 384 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -1 Query: 194 IFYLILLFDHQVLDEPSAGLAPGMRERLQEDIPGCLHVVTG 72 +F L+L + + S+GLAP + IP ++VTG Sbjct: 25 LFLLVLTLSSRKPSDSSSGLAPNRNLATKSTIPRFAYLVTG 65 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,613,288 Number of Sequences: 28952 Number of extensions: 273443 Number of successful extensions: 643 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 993966856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -