BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20139 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 27 0.43 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 26 1.3 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 1.7 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 25 1.7 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 25 1.7 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 1.7 AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-tran... 25 1.7 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 25 3.0 AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-tran... 25 3.0 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 24 4.0 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 24 4.0 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 24 4.0 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 24 4.0 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 24 4.0 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 4.0 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 4.0 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 24 4.0 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 4.0 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 24 4.0 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 4.0 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 4.0 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 4.0 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 4.0 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 4.0 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 4.0 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 4.0 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 24 4.0 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 23 7.0 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 7.0 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 9.2 U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 23 9.2 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 27.5 bits (58), Expect = 0.43 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 202 GSIPSVSSMQPPAPLP 249 G PS SS QPP PLP Sbjct: 170 GGQPSASSRQPPTPLP 185 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 25.8 bits (54), Expect = 1.3 Identities = 22/65 (33%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Frame = +3 Query: 255 PGMPMNQPQPYIPMMPNYSQSQAS-VTPAAFPTTAPNLVPTFDMSNFAATPIQPPPISTG 431 P Q P +P SQSQAS TPA P + P+ S + PPPI Sbjct: 631 PSAYQQQQPPVVPPPRTNSQSQASEPTPALPPRADRDSKPS---SRDRPKDLPPPPIPAS 687 Query: 432 VSVVT 446 S T Sbjct: 688 GSSST 692 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 25.4 bits (53), Expect = 1.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 202 GSIPSVSSMQPPAPLP 249 G PS S QPP PLP Sbjct: 194 GGQPSASPRQPPTPLP 209 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 148 SNMAAYSSNFADATLTQLGSIPSVSSMQPPAPLPS 252 S++ SNF AT L + PSV S++P A P+ Sbjct: 53 SHLTEPPSNFYQATHGLLQTHPSVPSLKPVAGAPA 87 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 148 SNMAAYSSNFADATLTQLGSIPSVSSMQPPAPLPS 252 S++ SNF AT L + PSV S++P A P+ Sbjct: 53 SHLTEPPSNFYQATHGLLQTHPSVPSLKPVAGAPA 87 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +3 Query: 276 PQPYI-PMMPNYSQSQASVTPAAFPTTAPNLVPTFDMSNFAATPIQPPPI 422 PQP + P++P+ + P+ PTT P ++ + P++ PP+ Sbjct: 86 PQPSLAPVVPSSVVTAPPARPSQPPTTRFAPEPRAEVKFVPSVPLKTPPV 135 >AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-transferase protein. Length = 229 Score = 25.4 bits (53), Expect = 1.7 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 335 WSHRSLRLTIIWHHWYVWLR 276 W H + R T + YVWLR Sbjct: 103 WQHHNTRATCAIYFQYVWLR 122 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 388 ILLQHQYNHLQFQQEYQL*HLSHY 459 I+L HQ + Q QQ+ QL H H+ Sbjct: 142 IVLHHQAHQQQQQQQQQLHHHHHH 165 >AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-transferase protein. Length = 235 Score = 24.6 bits (51), Expect = 3.0 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 338 SWSHRSLRLTIIWHHWYVWL 279 SW H +LR + + ++VWL Sbjct: 103 SWQHLNLRADVSLYFFHVWL 122 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 24.2 bits (50), Expect = 4.0 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 2/66 (3%) Frame = +3 Query: 264 PMNQPQPYIPMMPNYSQSQASVTPAAFPTTAP--NLVPTFDMSNFAATPIQPPPISTGVS 437 P + P P P + SQS S T T +P T ++ + P +S Sbjct: 9 PQSAPSP--PHHHHSSQSPTSTTTVTMATASPVPACTTTTSTTSTSGASAASSPTRDEMS 66 Query: 438 VVTPVS 455 VV P+S Sbjct: 67 VVVPIS 72 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 24.2 bits (50), Expect = 4.0 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 2/66 (3%) Frame = +3 Query: 264 PMNQPQPYIPMMPNYSQSQASVTPAAFPTTAP--NLVPTFDMSNFAATPIQPPPISTGVS 437 P + P P P + SQS S T T +P T ++ + P +S Sbjct: 9 PQSAPSP--PHHHHSSQSPTSTTTVTMATASPVPACTTTTSTTSTSGASAASSPTRDEMS 66 Query: 438 VVTPVS 455 VV P+S Sbjct: 67 VVVPIS 72 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 24.2 bits (50), Expect = 4.0 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +2 Query: 35 LRISLMNNICSIHXXXXXXXXXXXQPNSHHPPLHSLWY 148 ++I+L+N+ H P+ HHP H L Y Sbjct: 111 MKINLLNHHQHHHQHPHLPHVQQHHPSVHHPAHHPLHY 148 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/21 (42%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 602 IHLLA--LNDIYFIKLMKCSK 658 IHL+ +ND+YF+++ CS+ Sbjct: 437 IHLVPSKVNDVYFLRMAVCSR 457 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/21 (42%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 602 IHLLA--LNDIYFIKLMKCSK 658 IHL+ +ND+YF+++ CS+ Sbjct: 468 IHLVPSKVNDVYFLRMAVCSR 488 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 80 IIKSVEHHAPANYEFSYSVHDEHTGDIK 107 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTGDIK 99 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTGDIK 99 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTGDIK 99 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 80 IIKSVEHHAPANYEFSYSVHDEHTGDIK 107 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTGDIK 99 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 80 IIKSVEHHAPANYEFSYSVHDEHTGDIK 107 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 104 IIKSVEHHAPANYEFSYSVHDEHTGDIK 131 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTGDIK 99 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 80 IIKSVEHHAPANYEFSYSVHDEHTGDIK 107 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTGDIK 99 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 80 IIKSVEHHAPANYEFSYSVHDEHTGDIK 107 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 221 LVCSLQHHCPVSWYADESASAIHTNDAK 304 ++ S++HH P ++ S HT D K Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTGDIK 99 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 23.4 bits (48), Expect = 7.0 Identities = 11/43 (25%), Positives = 18/43 (41%) Frame = +3 Query: 291 PMMPNYSQSQASVTPAAFPTTAPNLVPTFDMSNFAATPIQPPP 419 PM+ SQ + PTT PT +++++ P P Sbjct: 375 PMLNEESQPDTFINRVQAPTTPAKWRPTVNIADYENRPTSTRP 417 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +3 Query: 345 PTTAPNLVPTFDMSNFAATPIQPP 416 P PN +PT S PIQ P Sbjct: 1273 PPNTPNGMPTHQHSQIQLQPIQQP 1296 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +3 Query: 231 ASSTTAQSPGMPMNQPQPYIPMMPNYSQSQASVTP 335 A ST + +P N+ + +P + Y S+ +TP Sbjct: 975 ADSTRFVTANLPCNKHKTRVPHILPYESSRVCLTP 1009 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 145 P*TVQRRMVTVGLAA 101 P TVQRR+V+ GL A Sbjct: 11 PRTVQRRLVSAGLLA 25 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 761,602 Number of Sequences: 2352 Number of extensions: 15686 Number of successful extensions: 65 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -