Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20138
         (666 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6TFB6 Cluster: Putative glycosyl transferase; n=1; The...    35   1.5  

>UniRef50_Q6TFB6 Cluster: Putative glycosyl transferase; n=1;
           Thermoanaerobacterium thermosaccharolyticum|Rep:
           Putative glycosyl transferase - Clostridium
           thermosaccharolyticum
           (Thermoanaerobacteriumthermosaccharolyticum)
          Length = 278

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
 Frame = -2

Query: 626 KRSSIYFKLLEGSHIICDKLQNHRVLFKLRPM*RYTINNKYKI--QSIVTYILTNNILCI 453
           K   IYF    G +   D + N +++FK  P   +T  NK K+    ++     NN  C+
Sbjct: 92  KYKDIYFCWSNGYYFFDDNIDNKQIIFKKIP--SWTKYNKEKLFKYFVINGNKVNNASCM 149

Query: 452 YSK*LFYAL*YF 417
           Y K LF  + YF
Sbjct: 150 YRKTLFDKIGYF 161


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 558,618,804
Number of Sequences: 1657284
Number of extensions: 9910760
Number of successful extensions: 18171
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 17428
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18167
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 50826451017
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)