BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20138 (666 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0140 - 18358997-18359082,18359255-18359318,18359469-183595... 28 7.7 >05_04_0140 - 18358997-18359082,18359255-18359318,18359469-18359583, 18360101-18360216,18360420-18360541,18360628-18360757, 18361328-18361420 Length = 241 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 200 NVYLIFKIVYILKHVLYYINHFNMTKFNLCKLESF 304 NVYL+F ++ + + Y N + FNL + E F Sbjct: 157 NVYLVFLVLVLFSCLTYVHNANGIESFNLSRQEHF 191 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,704,559 Number of Sequences: 37544 Number of extensions: 223591 Number of successful extensions: 298 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -