BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20137 (641 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 45 0.001 UniRef50_O31530 Cluster: YetA protein; n=3; Bacillus|Rep: YetA p... 34 3.4 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 45.2 bits (102), Expect = 0.001 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -2 Query: 217 FLLLR*VDELTAHLVLGGYWSP 152 FLLLR VDELTAHLVL GYWSP Sbjct: 154 FLLLRWVDELTAHLVLSGYWSP 175 >UniRef50_O31530 Cluster: YetA protein; n=3; Bacillus|Rep: YetA protein - Bacillus subtilis Length = 857 Score = 33.9 bits (74), Expect = 3.4 Identities = 11/39 (28%), Positives = 27/39 (69%) Frame = +3 Query: 180 WAVSSSTHLSNKKKQPQLDRDFVCYEQEIKKKRRFRFYY 296 W++ ++H K+ + QLD F+ Y++E++++R + F++ Sbjct: 461 WSIIDTSHPLKKELEEQLDAAFLFYKKEVEQRRWYGFWH 499 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 491,607,823 Number of Sequences: 1657284 Number of extensions: 8382636 Number of successful extensions: 14945 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14941 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48126133708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -