BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20137 (641 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0066 - 11081446-11081544,11081639-11081846,11083122-110832... 29 3.1 07_03_1050 - 23570785-23570824,23570938-23571004,23571114-235711... 29 4.1 >06_02_0066 - 11081446-11081544,11081639-11081846,11083122-11083257, 11083339-11083541,11083616-11083765,11083848-11083964, 11084623-11085119 Length = 469 Score = 29.1 bits (62), Expect = 3.1 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = -1 Query: 290 ESKSTLFFYFLLIADEVTIQLRLFFFIA*MSGRAHSPPSVRWLLEPIDIYNVNAPPTLRY 111 E K+ FY LI+D V + L + FFIA +R L E + + +RY Sbjct: 175 EKKAVYTFYLELISDLVHLSLYMLFFIAIFLNYGVPLHLIRELYETFRNFRIRIADYVRY 234 Query: 110 K 108 + Sbjct: 235 R 235 >07_03_1050 - 23570785-23570824,23570938-23571004,23571114-23571196, 23572028-23572201,23572268-23572471,23572570-23573300 Length = 432 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 273 FFLFPAHSRRSHDPVEAVFFYCLD 202 + FP HS+ + D VE F YCL+ Sbjct: 284 YMTFPVHSKFTDDDVENYFKYCLN 307 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,409,824 Number of Sequences: 37544 Number of extensions: 209132 Number of successful extensions: 334 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 334 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -