BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20132 (714 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC107127-1|AAI07128.1| 431|Homo sapiens astacin-like metallo-en... 30 7.2 BC107126-1|AAI07127.1| 430|Homo sapiens ASTL protein protein. 30 7.2 AJ537600-1|CAD61265.2| 431|Homo sapiens oocyte astacin protein. 30 7.2 >BC107127-1|AAI07128.1| 431|Homo sapiens astacin-like metallo-endopeptidase (M12 family) protein. Length = 431 Score = 30.3 bits (65), Expect = 7.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 258 VLGTSYDMETSRNIFLEALPHARSEACARFIKY 356 +L + YD E SR + LEAL C RF+ Y Sbjct: 107 LLSSKYD-EPSRQVILEALAEFERSTCIRFVTY 138 >BC107126-1|AAI07127.1| 430|Homo sapiens ASTL protein protein. Length = 430 Score = 30.3 bits (65), Expect = 7.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 258 VLGTSYDMETSRNIFLEALPHARSEACARFIKY 356 +L + YD E SR + LEAL C RF+ Y Sbjct: 106 LLSSKYD-EPSRQVILEALAEFERSTCIRFVTY 137 >AJ537600-1|CAD61265.2| 431|Homo sapiens oocyte astacin protein. Length = 431 Score = 30.3 bits (65), Expect = 7.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 258 VLGTSYDMETSRNIFLEALPHARSEACARFIKY 356 +L + YD E SR + LEAL C RF+ Y Sbjct: 107 LLSSKYD-EPSRQVILEALAEFERSTCIRFVTY 138 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,833,625 Number of Sequences: 237096 Number of extensions: 2480678 Number of successful extensions: 8942 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8942 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8343197486 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -