BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20129 (671 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 2.3 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 5.3 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 6.9 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 314 ETNECYSSSCKNVGRIISCSRY*SW*WNNISSCYCWCVFGF 436 + NEC S+ C N G + C + ++ +C C GF Sbjct: 298 DINECLSNPCSNAG-TLDCVQL-------VNDYHCNCKLGF 330 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 231 CADGISNSFCGIYVAQSD 178 C+DG S S+C + + D Sbjct: 172 CSDGYSGSYCQTEINECD 189 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 314 ETNECYSSSCKNVG 355 E NEC S+ C+N G Sbjct: 184 EINECDSAPCQNGG 197 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 5.3 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 497 SPSIALQVVENMSTPVDLNNEDALLKAAATSLNSKVVSQHS 619 +PS A + +E MS L ED A + + ++HS Sbjct: 320 TPSDATKALEKMSELSKLGGEDLFRTMANAAPGNSASNRHS 360 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +3 Query: 186 EQHKCRKSCC*CHPHKLRASWNGKMIQAANGEV 284 EQ + +C +R SW + AANG + Sbjct: 1101 EQPPDKATCTTLTAQTIRVSWVSPPLTAANGVI 1133 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,179 Number of Sequences: 336 Number of extensions: 3031 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -