BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20127 (531 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 4.8 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 6.4 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 23 8.4 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 23 8.4 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 23 8.4 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/46 (21%), Positives = 25/46 (54%) Frame = +2 Query: 374 YSNIIILPILFYIEKREIYVYFFAEIIVFF*YFKVSYDLYRNKRMY 511 +S +IIL ++ ++ ++E+ V+F ++ V Y D +++ Sbjct: 1039 FSLVIILTLVLFVFRQEMRVWFHSKFGVRLFYRNADIDKNERDKLF 1084 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.0 bits (47), Expect = 6.4 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -2 Query: 284 YFLMYYLNECYYYIHLDNNFQAIKIQLR--YSIFSKSMFNIFLSFLL 150 YF Y NE Y++ N FQ I QL + ++ S + SF + Sbjct: 1576 YFTFPYWNEDYFFQGKHNQFQ-IDFQLAPYFDYYNASFYGSDRSFAI 1621 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 22.6 bits (46), Expect = 8.4 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 287 YYFLMYYLNE 258 YYF++YYL E Sbjct: 488 YYFIIYYLTE 497 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 22.6 bits (46), Expect = 8.4 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 287 YYFLMYYLNE 258 YYF++YYL E Sbjct: 488 YYFIIYYLTE 497 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 22.6 bits (46), Expect = 8.4 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 287 YYFLMYYLNE 258 YYF++YYL E Sbjct: 374 YYFIIYYLTE 383 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 424,971 Number of Sequences: 2352 Number of extensions: 6847 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49051644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -