BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20127 (531 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26240.1 68418.m03129 chloride channel protein (CLC-d) identi... 29 2.0 >At5g26240.1 68418.m03129 chloride channel protein (CLC-d) identical to CLC-d chloride channel protein [Arabidopsis thaliana] GI:1742959 Length = 792 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 248 YIHLD-NNFQAIKIQLRYSIFSKSMFNIFLSFLLITHVLV 132 +I+L NF K L ++I KS F F+ +LLI VLV Sbjct: 93 FINLSVENFAGWKFALTFAIIQKSYFAGFIVYLLINLVLV 132 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,395,155 Number of Sequences: 28952 Number of extensions: 138949 Number of successful extensions: 239 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 239 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 987020800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -