BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20126 (567 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117752-1|AAD38338.1| 155|Anopheles gambiae serine protease 2A... 23 5.3 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 23 9.2 >AF117752-1|AAD38338.1| 155|Anopheles gambiae serine protease 2A protein. Length = 155 Score = 23.4 bits (48), Expect = 5.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 221 YRIIVITRYFGHVYD*NDWKIVIDKNNPIKKQWITLICLH 102 Y I + + GH ND ++ KNN KQ + ICL+ Sbjct: 32 YEIKQVHLHEGHKSRRNDIALIELKNNVTYKQDVGPICLN 71 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 22.6 bits (46), Expect = 9.2 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -1 Query: 372 FIIRQNRKVRN*FRLFTEILLKFFM*NYSASVFN*NKILY 253 F R+ RKVR E ++F + +AS+F +KI++ Sbjct: 31 FCARRPRKVRKLLPHHVEARIRFAEEHLAASIFWWSKIIF 70 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 498,745 Number of Sequences: 2352 Number of extensions: 9258 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -