BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20126 (567 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17565.1 68417.m02626 F-box family protein contains F-box dom... 28 3.8 At2g18690.1 68415.m02177 expressed protein 28 3.8 >At4g17565.1 68417.m02626 F-box family protein contains F-box domain Pfam:PF00646 Length = 378 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/50 (24%), Positives = 25/50 (50%) Frame = -2 Query: 269 KTRYYIKQKECTTIFNYRIIVITRYFGHVYD*NDWKIVIDKNNPIKKQWI 120 K +YY + + ++V+ H YD + W+ I + NP+ ++W+ Sbjct: 250 KNKYYRISHQMVMSLSGEVVVVK--IMHYYDLSRWRFRIFELNPLTQRWV 297 >At2g18690.1 68415.m02177 expressed protein Length = 322 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 147 FIYNDFPIVLIIDMSKITRNYYYAVIKNSGAFFLFYIVSC 266 F DFP++ + Y+Y + + G FLF+I+ C Sbjct: 126 FNIKDFPVLSLKSWKGPLVTYFYIALFSLGFGFLFFIILC 165 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,939,623 Number of Sequences: 28952 Number of extensions: 174518 Number of successful extensions: 303 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 303 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1092379416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -