BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20124 (631 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 9.9 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 9.9 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 9.9 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 Query: 193 NAKRLLWPSNAFGTLPVPDSRDIHC 267 N K+L + N +PVP I+C Sbjct: 108 NCKKLYYNINYIEQIPVPVPVPIYC 132 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 9.9 Identities = 12/55 (21%), Positives = 17/55 (30%) Frame = +2 Query: 236 YPCQTRGTSTAIDVEPAFVENFPPAQEFEVTPKALVSATSDYESDGEEAFPELEV 400 Y C + N PP E T KA + + FP+ +V Sbjct: 656 YVCTAENAAGTASHSTTLTVNVPPRWILEPTDKAFAQGSDARVECKADGFPKPQV 710 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 303 LQHRNSKLLLKRL 341 LQHR S +LKRL Sbjct: 57 LQHRGSSGMLKRL 69 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,314 Number of Sequences: 438 Number of extensions: 4180 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -