BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20123 (745 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF079508-1|AAC28387.1| 1156|Caenorhabditis elegans germline RNA ... 33 0.28 AF039718-2|AAB96745.2| 1156|Caenorhabditis elegans Germ-line hel... 33 0.28 AF016424-9|AAB65327.2| 530|Caenorhabditis elegans Udp-glucurono... 28 6.1 AF022979-6|ABD94088.1| 94|Caenorhabditis elegans Hypothetical ... 28 8.0 >AF079508-1|AAC28387.1| 1156|Caenorhabditis elegans germline RNA helicase-4 protein. Length = 1156 Score = 32.7 bits (71), Expect = 0.28 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 192 CQKCLEFGHWSYECKGKRKIL 254 C++C E GHW YEC + K L Sbjct: 667 CRRCAEEGHWGYECPTRPKDL 687 >AF039718-2|AAB96745.2| 1156|Caenorhabditis elegans Germ-line helicase protein 4 protein. Length = 1156 Score = 32.7 bits (71), Expect = 0.28 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 192 CQKCLEFGHWSYECKGKRKIL 254 C++C E GHW YEC + K L Sbjct: 667 CRRCAEEGHWGYECPTRPKDL 687 >AF016424-9|AAB65327.2| 530|Caenorhabditis elegans Udp-glucuronosyltransferase protein61 protein. Length = 530 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +2 Query: 173 FSSRHKMPEVLGVWTLEL*VQGQTQDPIRPSRTRIMHKNLKAKEEGQ 313 F S K+P+ + + L+ V+G T+ I ++ +++KN+ K+ Q Sbjct: 59 FESNVKVPKGVKTYQLDAAVEGITKQSIEKEQSAMLYKNMGLKDMPQ 105 >AF022979-6|ABD94088.1| 94|Caenorhabditis elegans Hypothetical protein T02B11.8 protein. Length = 94 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 509 CCQIQNHCCSLNQTRSPIHCCCHYQTSSNP 420 CC NHCC + + I C T SNP Sbjct: 58 CCPGTNHCCPPGFSCTTIGTCKRTTTLSNP 87 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,447,232 Number of Sequences: 27780 Number of extensions: 224685 Number of successful extensions: 756 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1756472266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -