BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20121 (630 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22E12.10c |etp1|cox15|mitochondrial type I [2Fe-2S] ferredox... 25 6.8 SPCC188.08c |ubp22|ubp5|ubiquitin C-terminal hydrolase Ubp22|Sch... 25 6.8 SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyce... 25 6.8 SPAC15A10.10 |mde6||Muskelin homolog|Schizosaccharomyces pombe|c... 25 9.0 >SPAC22E12.10c |etp1|cox15|mitochondrial type I [2Fe-2S] ferredoxin Etp1/ cytochrome oxidase cofactor Cox15, fusion|Schizosaccharomyces pombe|chr 1|||Manual Length = 631 Score = 25.4 bits (53), Expect = 6.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 394 NLIISQCTFSRKNFEKF 344 NL ++ C F++ +FEKF Sbjct: 54 NLFLNDCKFNKNSFEKF 70 >SPCC188.08c |ubp22|ubp5|ubiquitin C-terminal hydrolase Ubp22|Schizosaccharomyces pombe|chr 3|||Manual Length = 1108 Score = 25.4 bits (53), Expect = 6.8 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 294 SRKCSDTMRGRGTWQSSNFSKFFLEKVHWEIIKFNN 401 SR+ T +GT QS+ F+ FLE + E K +N Sbjct: 81 SRQFKITYFPQGTLQSAGFTSIFLEYIPSEEEKLSN 116 >SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 715 Score = 25.4 bits (53), Expect = 6.8 Identities = 12/53 (22%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +3 Query: 246 FEFPNSIKRYSYRSKLSRKCSDTMRGR-GTWQSSNFSKFFLEKVHWEIIKFNN 401 +EF Y S + C + + ++ S ++ +EK +W+++K NN Sbjct: 340 YEFGFETGNYYTLSNFEKYCDNFKKNYFSKFKDSEITEDIVEKEYWKLVKDNN 392 >SPAC15A10.10 |mde6||Muskelin homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 716 Score = 25.0 bits (52), Expect = 9.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 312 YQNIYDLI*IDTNTVLLN 259 +Q IYDL+ +D NTV N Sbjct: 688 FQTIYDLLPVDENTVAPN 705 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,305,705 Number of Sequences: 5004 Number of extensions: 42361 Number of successful extensions: 106 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -