BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20121 (630 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U49944-3|AAM51525.1| 341|Caenorhabditis elegans Mesodermal line... 28 4.8 AL132862-14|CAB60548.1| 541|Caenorhabditis elegans Hypothetical... 28 6.3 >U49944-3|AAM51525.1| 341|Caenorhabditis elegans Mesodermal lineage specificationprotein 2 protein. Length = 341 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 101 QEETLNIQNKTNHTTSLLVFPLKSLHTSYVRRYRRFSN 214 Q+ LN+ N+ N + L +FP L T+ + ++ SN Sbjct: 103 QQTFLNVGNQQNMISPLTMFPFFGLPTAQLMHFKNMSN 140 >AL132862-14|CAB60548.1| 541|Caenorhabditis elegans Hypothetical protein Y73F8A.20 protein. Length = 541 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 376 CTFSRKNFEKFEDCHVPRPRIVSEHLRL 293 CTF RK FE+F + R++ +H + Sbjct: 217 CTFHRKKFEEFFEIRTTYRRVLMDHFEV 244 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,359,798 Number of Sequences: 27780 Number of extensions: 224486 Number of successful extensions: 581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1385109898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -