BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20119 (605 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 25 0.58 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.3 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 2.3 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 7.1 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 25.0 bits (52), Expect = 0.58 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 467 RLSCDCILREINVLD 423 +L C+CIL+ N+LD Sbjct: 60 QLYCECILKNFNILD 74 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 178 MPRGQRFSLDYFSLLR 131 +PRG+ FSL Y LLR Sbjct: 91 LPRGELFSLYYPQLLR 106 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 178 MPRGQRFSLDYFSLLR 131 +PRG+ FSL Y LLR Sbjct: 91 LPRGELFSLYYPQLLR 106 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.0 bits (47), Expect = 2.3 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +3 Query: 399 SRDVFNSDVQNIDFSKNTVAAKSINDWVEENTNNRIKI*LIRTRSAQPQRLFSSTPS-IS 575 S ++ + QNID +KNT+ ND + N R + Q R++ S P+ I Sbjct: 410 SMEINQNIAQNIDHAKNTIIDYRNND-LSINEEKR------TIENEQLNRMYKSYPNYID 462 Query: 576 REHGVLNL 599 +E +NL Sbjct: 463 KETKDMNL 470 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +1 Query: 151 PGKSVVLSAFSVLPPLAQLALASDGET 231 P K + AF PPL + A+ +T Sbjct: 406 PSKPMCAEAFQEFPPLGRFAVRDMRQT 432 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,663 Number of Sequences: 438 Number of extensions: 3409 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -