BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20117 (622 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41960.1 68418.m05109 expressed protein 31 0.62 At1g50420.1 68414.m05651 scarecrow-like transcription factor 3 (... 29 3.3 At1g47765.1 68414.m05312 F-box family protein contains F-box dom... 29 3.3 At1g01980.1 68414.m00116 FAD-binding domain-containing protein s... 28 4.3 At3g03480.1 68416.m00346 transferase family protein similar to h... 27 7.6 >At5g41960.1 68418.m05109 expressed protein Length = 217 Score = 31.1 bits (67), Expect = 0.62 Identities = 21/72 (29%), Positives = 30/72 (41%) Frame = -2 Query: 573 ATANPLPLLQSLQRSIRYFPGISATYMSISFSTIIFVCYVVGACFLSGLDFIITKNHFVD 394 ++ +PLPL LQ + I FS + +GAC LS F + K + Sbjct: 30 SSPSPLPLAYPLQNPKKLCRKIERVICRAEFSQDAPLVTAIGACILSSFVFPVAKRVNDE 89 Query: 393 GEHRYDGYIVST 358 E + IVST Sbjct: 90 EEEEENSAIVST 101 >At1g50420.1 68414.m05651 scarecrow-like transcription factor 3 (SCL3) identical to GB:AAD24404 GI:4580515 from [Arabidopsis thaliana] (Plant J. 18 (1), 111-119 (1999)) Length = 482 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -3 Query: 209 PFQLFLNYCIVRNPLLLASQIPLHCRNILYPNRKDYTLSELV 84 P Q+F + R P LLAS P HC L P + L L+ Sbjct: 18 PLQVFSTMSLNR-PTLLASSSPFHCLKDLKPEERGLYLIHLL 58 >At1g47765.1 68414.m05312 F-box family protein contains F-box domain Pfam:PF00646 Length = 385 Score = 28.7 bits (61), Expect = 3.3 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = -3 Query: 245 PYLF-LFPFRNKLPFQLFLNYCIVRNPLLLASQIPLHCRNILYPNRKDYTLSELVRIRTW 69 PY LF R+ P L C + N L S IP H + L +++ Y+ S+L + W Sbjct: 60 PYFINLFETRSPRPSLLV---CFIENDKLFVSSIPQHLHS-LQNSKRSYSSSQLFIVIIW 115 >At1g01980.1 68414.m00116 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 541 Score = 28.3 bits (60), Expect = 4.3 Identities = 21/70 (30%), Positives = 31/70 (44%) Frame = -3 Query: 395 MENIVTTGTSFPLEFRIFRSNVKRSCKGPIGRIII*CQLFLTTTKVVFVMPYLFLFPFRN 216 M + TT T FP R+F+ + K P G + F+ T+ Y ++ PF Sbjct: 417 MSEVATTATPFPHRKRLFKVQHSMNWKDP-GTDVE--SSFMEKTRSF----YSYMAPFVT 469 Query: 215 KLPFQLFLNY 186 K P +LNY Sbjct: 470 KNPRHTYLNY 479 >At3g03480.1 68416.m00346 transferase family protein similar to hypersensitivity-related gene GB:CAA64636 [Nicotiana tabacum]; contains Pfam transferase family domain PF00248 Length = 454 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = -3 Query: 230 FPFRNKLPFQLFLNYCIVRNPLLLASQIPLHCRNILYPNRKDYTLSE 90 FPF +L F + + ++ PLLL L C ++ R ++T+++ Sbjct: 132 FPFLEELLFDVEGSSDVLNTPLLLVQVTRLKCCGFIFALRFNHTMTD 178 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,327,487 Number of Sequences: 28952 Number of extensions: 276311 Number of successful extensions: 679 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -