BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20112 (629 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 23 2.8 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 3.7 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.9 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 8.5 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 278 LQIKCPFYVWSIIQQCPIVRWPR 346 LQ+ +V S I P+ RWP+ Sbjct: 1 LQVDMQLFVLSPIILIPLFRWPK 23 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 512 PGGKLHSRRGVNQPNNNSLKWHLKSHFRI*LTKMNS 619 PG KL ++ PN N LK + + + + K +S Sbjct: 134 PGIKLSINIILSDPNTNKLKLNTNESYELTVLKSDS 169 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 4.9 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -1 Query: 254 PRTRPSSLQAYLAFRGLELSSNSHILSLSTHS 159 PRTR A + +E+SSNS L LS S Sbjct: 1484 PRTRGEKPIVPSAEKFIEVSSNSITLHLSAWS 1515 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.0 bits (42), Expect = 8.5 Identities = 7/26 (26%), Positives = 12/26 (46%) Frame = +2 Query: 401 NWTFLSRKGHIRLKMKSISRSTTRRG 478 +W + + HI +KS S + G Sbjct: 83 DWVYYESRAHIHCSVKSESSQAAKYG 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,717 Number of Sequences: 336 Number of extensions: 3406 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -