BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20111 (684 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13070.1 68418.m01498 MSF1-like family protein similar to px1... 39 0.004 At4g24790.1 68417.m03550 expressed protein ; expression supporte... 31 0.71 At3g28870.1 68416.m03604 hypothetical protein 31 0.94 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 30 1.6 At1g58260.1 68414.m06625 cytochrome P450 family protein similar ... 29 2.2 At1g09320.1 68414.m01043 agenet domain-containing protein contai... 29 3.8 At5g57750.1 68418.m07219 zinc finger (C3HC4-type RING finger) fa... 28 5.0 At5g52580.1 68418.m06529 hypothetical protein 28 5.0 At5g67240.1 68418.m08475 exonuclease family protein contains exo... 27 8.8 >At5g13070.1 68418.m01498 MSF1-like family protein similar to px19 [Gallus gallus] GI:969170; contains Pfam profile PF04707: MSF1-like conserved region Length = 183 Score = 38.7 bits (86), Expect = 0.004 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 6/87 (6%) Frame = +1 Query: 1 VAQAAWRKYPNPMNPAVIG----TDVVERKV--VDGVLHTHRLVSSKWFFPRWAQALIGT 162 V+ A+WRK+ +P N ++ D + RK+ G LHT R ++ P + +IG Sbjct: 18 VSAASWRKFADPENKRILSHILEVDTLNRKLDTETGKLHTTRALTIHAPGPWFLHRIIG- 76 Query: 163 AKICYASEISEVNPIQRQMTLKTTNLT 243 IC+ E + V+ R M L T N++ Sbjct: 77 QDICHCVESTVVDGKSRSMQLTTKNIS 103 Score = 36.7 bits (81), Expect = 0.014 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 5/77 (6%) Frame = +3 Query: 240 NILSLIAVDETVRYTPHPSD-SSKTLLKQEAVVTVQGV----PLSSYMEDLLTNKISLNA 404 ++ I V+E +RY PHP + S+ T+ QE + ++ + ++ +E K N+ Sbjct: 103 SLKKFIEVEERIRYDPHPDNPSAWTVCSQETSIRIKPLSALASMAEKVEQKCAEKFMQNS 162 Query: 405 GKGRQAIEWVIGKFDTE 455 KGR+ +E + + E Sbjct: 163 AKGREVMERICKYMEAE 179 >At4g24790.1 68417.m03550 expressed protein ; expression supported by MPSS Length = 815 Score = 31.1 bits (67), Expect = 0.71 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -1 Query: 663 QRHAYYSSFQLLWLALALVNFSISSSVLFALDEISSIDLLADVVMSS 523 ++H S Q WL +AL+ S + S FA DE + DV +SS Sbjct: 567 EKHLRASKNQTTWLTVALLQLSNTDSSSFATDENGRNQINKDVELSS 613 >At3g28870.1 68416.m03604 hypothetical protein Length = 355 Score = 30.7 bits (66), Expect = 0.94 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 2/78 (2%) Frame = +3 Query: 441 KFDTEIKELASSACKSTDELLSQQRSQLMTSQHQQEDQWMISHLKQK-AHLMI*KN*LKL 617 K + E+K+L + + + L + + +T HQ+ ++S LKQK H+ + LK Sbjct: 181 KGEMELKDLGAKFYRCVEMLYGEDMFETVTEDHQRALPMILSRLKQKLRHVTTARERLKP 240 Query: 618 MPTRGAEKRS-NMHASAI 668 + + EK S N S I Sbjct: 241 LWKQTIEKLSTNQRGSTI 258 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +3 Query: 294 SDSSKTLLKQEAVVTVQGVPLSSYMEDLLTNKISL 398 +DSSKT +KQE + T++G L + LL N + + Sbjct: 424 ADSSKTTMKQEFMNTMKGEGLRGFYRGLLPNLLKV 458 >At1g58260.1 68414.m06625 cytochrome P450 family protein similar to cytochrome P450 GI:984542 from [Sorghum bicolor] Length = 530 Score = 29.5 bits (63), Expect = 2.2 Identities = 8/44 (18%), Positives = 26/44 (59%) Frame = +1 Query: 169 ICYASEISEVNPIQRQMTLKTTNLTFCH*LLLMKLYGILHILQI 300 + Y + ++ +++ + ++ T LT+CH +++ ++G H ++ Sbjct: 164 VTYVYNLCQLGSVRKPINVRDTILTYCHAVMMRMMFGQRHFDEV 207 >At1g09320.1 68414.m01043 agenet domain-containing protein contains Pfam PF05641: Agenet domain Length = 517 Score = 28.7 bits (61), Expect = 3.8 Identities = 29/104 (27%), Positives = 43/104 (41%), Gaps = 1/104 (0%) Frame = +3 Query: 273 VRYTPHPSDSSKTLLKQEAVVT-VQGVPLSSYMEDLLTNKISLNAGKGRQAIEWVIGKFD 449 V Y ++ K L++E V+ ++ +PL S M +NA VI K Sbjct: 415 VEYDNLKAEDGKEPLREEVNVSRIRPLPLESVMVSPFERHDKVNALYNDGWWVGVIRKVL 474 Query: 450 TEIKELASSACKSTDELLSQQRSQLMTSQHQQEDQWMISHLKQK 581 + L K+T ELL SQL Q + +W+ S QK Sbjct: 475 AKSSYLV--LFKNTQELLKFHHSQLRLHQEWIDGKWITSFKSQK 516 >At5g57750.1 68418.m07219 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 zinc finger protein ATL4 [Arabidopsis thaliana] GI:4928399; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 210 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = -1 Query: 627 WLALALVNFSISSSVLFALDEISSID--LLADVVMSSIDFFVVIIIHL 490 +L+++ ++FS SSS D I I +L + + SI FFV +IHL Sbjct: 8 FLSVSSISFSYSSSTDKDFDLICMISPIVLLYITLLSIIFFVAALIHL 55 >At5g52580.1 68418.m06529 hypothetical protein Length = 327 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = -1 Query: 609 VNFSISSSVLFALDEISSIDLLADVVMSSIDFFVVIIIHL 490 + S S + L DEIS ID+ AD + +I FFV+ I L Sbjct: 272 IRHSYSENDLLKDDEISYIDVPADPLEVTIIFFVISITML 311 >At5g67240.1 68418.m08475 exonuclease family protein contains exonuclease domain, Pfam:PF00929 Length = 745 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 542 ARRSMDDISSKAKSTLDDIEKLTKANANQR 631 AR +++SSK + T D+ E+ +A NQR Sbjct: 398 ARAEENNVSSKRQKTEDETEETKEATVNQR 427 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 542 ARRSMDDISSKAKSTLDDIEKLTKANANQR 631 AR ++SSK + T D+ E+ +ANA QR Sbjct: 537 ARTEESNMSSKRQKTEDESEETKEANAKQR 566 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,751,012 Number of Sequences: 28952 Number of extensions: 296455 Number of successful extensions: 854 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 852 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -