BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20110 (575 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 24 1.1 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 1.4 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 4.3 AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochr... 21 7.5 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 9.9 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 9.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 9.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.9 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 28 ALVLCGLLAAVSAAPQYY 81 A++LC L AVSAA Y Sbjct: 6 AVILCAFLVAVSAAENKY 23 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.4 bits (48), Expect = 1.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 387 NLPWDVNSEGSWV 425 N WDV+S GSW+ Sbjct: 187 NAWWDVHSTGSWL 199 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.8 bits (44), Expect = 4.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 22 MIALVLCGLLAAVSAAPQYYHGSSHWPYHHYD 117 MI L+ + AVSAAP ++ S Y H D Sbjct: 1 MIPLIAIAGILAVSAAPAEFYESR---YDHLD 29 >AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 124 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +1 Query: 184 EMQHLDNMMKELSLKFPSI 240 EM++L+ ++KE +PS+ Sbjct: 43 EMKYLEMVLKEAQRLYPSV 61 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 150 GHTFALVQPCQRN 188 GHTF L P Q + Sbjct: 261 GHTFQLADPAQHD 273 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 185 SLARLDQSECVSNMLSRT*GLK 120 S+ RLDQ +C ++ GLK Sbjct: 8 SVFRLDQDQCSHRIVREHLGLK 29 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 185 SLARLDQSECVSNMLSRT*GLK 120 S+ RLDQ +C ++ GLK Sbjct: 322 SVFRLDQDQCSHRIVREHLGLK 343 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 185 SLARLDQSECVSNMLSRT*GLK 120 S+ RLDQ +C ++ GLK Sbjct: 555 SVFRLDQDQCSHRIVREHLGLK 576 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 185 SLARLDQSECVSNMLSRT*GLK 120 S+ RLDQ +C ++ GLK Sbjct: 555 SVFRLDQDQCSHRIVREHLGLK 576 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,981 Number of Sequences: 336 Number of extensions: 2788 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -