BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20110 (575 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 25 2.3 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 23 5.4 AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CY... 23 5.4 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 7.1 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 23 7.1 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 23 7.1 AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.1 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 23 7.1 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 7.1 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 7.1 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 7.1 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 7.1 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 7.1 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 7.1 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 7.1 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 7.1 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 7.1 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 7.1 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 7.1 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 7.1 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 7.1 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 9.4 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 9.4 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 23 9.4 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 23 9.4 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 23 9.4 AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 23 9.4 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 24.6 bits (51), Expect = 2.3 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 109 HYDPFSPYVRESMLDTHSLWSNLANEMQHLDNMMKELSLK 228 +Y P SPY R ML +L L+ +Q +D +MK+ L+ Sbjct: 4 YYHPASPYCRSVMLVAKAL--KLSLNLQFVD-LMKDEQLR 40 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 23.4 bits (48), Expect = 5.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 175 LANEMQHLDNMMKELSLKFPSIINEGR 255 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPMIGR 80 >AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CYP4D16 protein. Length = 151 Score = 23.4 bits (48), Expect = 5.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 175 LANEMQHLDNMMKELSLKFPSIINEGR 255 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPMFGR 80 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +2 Query: 347 AG*QCF*SLLENTEPSL----GCEFRRQLGLRERRVE 445 AG F +++ ++ PS+ G E +Q+GL ERRV+ Sbjct: 540 AGKTTFSNIIGSSGPSVTSCTGSEIDKQVGLWERRVK 576 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 23.0 bits (47), Expect = 7.1 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +1 Query: 94 HWPYHHYDPFSPYV--RESMLDTHS 162 HW +HH S YV R +L+T++ Sbjct: 298 HWQHHHSHHRSAYVQNRVQLLETNT 322 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 23.0 bits (47), Expect = 7.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 181 NEMQHLDNMMKELSLKFPSIINEGRWKATSIR 276 ++M++LD ++KE K+P + R A R Sbjct: 350 HDMKYLDQILKESLRKYPPVPMHFRMTAQDYR 381 >AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CYP4D15 protein. Length = 151 Score = 23.0 bits (47), Expect = 7.1 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 175 LANEMQHLDNMMKELSLKFPSIINEGR 255 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPLFGR 80 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 33 SVVRTAGGGLGRATVLPWLVTLAVSPLRPLQS 128 S V A GL T PWLVT + S L+ S Sbjct: 83 SSVGGAQSGLPDITRHPWLVTASQSALQKFAS 114 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 224 HGPSHLSHHHY 234 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 253 HGPSHLSHHHY 263 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 82 HGSSHWPYHHY 114 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 88 SSHWPYHHYDPFSPYVRES 144 ++++P+H Y+P S VR S Sbjct: 68 NANYPWHVYEPSSLIVRSS 86 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +1 Query: 73 QYYHGSSHWPYHHYDPFSPYVRESMLDTH 159 Q +H S H P HH + P +M H Sbjct: 132 QQHHPSVHHPAHHPLHYQPAAAAAMHHHH 160 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 184 EMQHLDNMMKELSLKFPSI 240 EM +LD ++KE K+P + Sbjct: 292 EMNYLDQILKESLRKYPPV 310 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 34 VLCGLLAAVSAAPQYYHGSSHWP 102 V CGLL + A HG H P Sbjct: 7 VACGLLCLLVIAIDQGHGQEHKP 29 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 22.6 bits (46), Expect = 9.4 Identities = 15/74 (20%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = +3 Query: 291 PGYEQKDINVKAKNGVLMVQANSAFNHYLKIQNLPWDVNSEGSWVYEKDVLKIT--FPLK 464 P Y+ +I+ +L + ++ FN Y++ LP+D + + + + ++ +T + Sbjct: 200 PEYDMHNISRPNDICILRLASDVTFNDYVRPICLPFDPDVQQLPIVD-EIFTVTGWGETE 258 Query: 465 QKQPEDSKRPVAEP 506 ++P D+++ V P Sbjct: 259 DRRPSDTQKHVELP 272 >AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR20 protein. Length = 175 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = +3 Query: 282 IHLPGYEQKDINVKAKNGVLMVQANSAFNHYLKIQNLPWDV 404 +H+P YE + + +G++ N+ F+ + PW V Sbjct: 106 VHIPPYEIEGCGHRNPHGMIFTIENNQFSE-SEYGEYPWTV 145 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,527 Number of Sequences: 2352 Number of extensions: 12442 Number of successful extensions: 86 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -