BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20105 (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27130.1 68418.m03238 MADS-box family protein various predict... 31 0.47 At4g09960.1 68417.m01629 MADS-box protein (AGL11) 31 0.83 At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related conta... 28 4.4 At1g77122.1 68414.m08984 expressed protein 28 4.4 At1g20430.1 68414.m02546 expressed protein 28 4.4 At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain... 28 5.8 At5g16730.1 68418.m01959 expressed protein weak similarity to mi... 27 7.7 At3g07530.1 68416.m00899 expressed protein ; expression supporte... 27 7.7 >At5g27130.1 68418.m03238 MADS-box family protein various predicted MADS box proteins, Arabidopsis thaliana Length = 306 Score = 31.5 bits (68), Expect = 0.47 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +3 Query: 258 RVERLRKDTVRI--EEEKDSLLSTLDSIKHSELLLDISECDKDDITRYA 398 R++R++K + +EEK L+S+ D +S LD+ +CD ++ A Sbjct: 126 RLQRMKKHVMACLEKEEKSQLVSSFDQNPNSTCSLDVEDCDGSSYSQIA 174 >At4g09960.1 68417.m01629 MADS-box protein (AGL11) Length = 230 Score = 30.7 bits (66), Expect = 0.83 Identities = 19/71 (26%), Positives = 33/71 (46%) Frame = +3 Query: 276 KDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVRTDRD 455 K+ ++E + +S + S KH LL++I K +I + I R EV R + Sbjct: 122 KELKQVENRLEKAISRIRSKKHELLLVEIENAQKREIELDNENIYLRTKVAEVE-RYQQH 180 Query: 456 HQQEEALYQVN 488 H Q + ++N Sbjct: 181 HHQMVSGSEIN 191 >At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 738 Score = 28.3 bits (60), Expect = 4.4 Identities = 20/70 (28%), Positives = 30/70 (42%) Frame = +2 Query: 404 HPVPGYDRRGDSAH*PRPSAGGSSVSGEHVHRSAGMSVHNDAVSAHSRCQTYMNACTSQP 583 HPV GY ++ + + G S+ + AG SV + Y ++C S P Sbjct: 513 HPVYGYLQKAEPVNLQFGLFGISAWPSDGATSRAG-SVDDCKADMAETSSRYYSSCCSSP 571 Query: 584 DPNAGTDKEL 613 + GT KEL Sbjct: 572 RMSEGTSKEL 581 >At1g77122.1 68414.m08984 expressed protein Length = 323 Score = 28.3 bits (60), Expect = 4.4 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 3/76 (3%) Frame = +3 Query: 165 GFTTTPHRRILG-SRNAGAERQTDSSTRSSRM-RVERLRKDTVRIEEEKDSLLSTLDSIK 338 GF TP RR + A+R+ +ST + +VE L + EEE++ ++ + + Sbjct: 42 GFPATPFRRTPNFTFKTHAKRKNKTSTFEPKPNKVEELIIEEEEEEEEEEEIVLPEEIQE 101 Query: 339 HS-ELLLDISECDKDD 383 + ELLLD E D+DD Sbjct: 102 NQDELLLD-DEYDEDD 116 >At1g20430.1 68414.m02546 expressed protein Length = 116 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +3 Query: 246 SSRMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELL 353 S + R+ L +DT +++E+DSL + IK S+LL Sbjct: 58 SQKYRIHDLEEDTAVLKKEQDSLTDRMSKIK-SDLL 92 >At5g64430.1 68418.m08093 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 513 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 229 VCLSAPAFLEPRIRR*GVVVNPLDTQSLMQ 140 V L P F +PR+ + VVNP++ Q MQ Sbjct: 220 VALEPPLFNDPRVIQPDHVVNPMEIQRQMQ 249 >At5g16730.1 68418.m01959 expressed protein weak similarity to microtubule binding protein D-CLIP-190 [Drosophila melanogaster] GI:2773363, SMC2-like condensin [Arabidopsis thaliana] GI:14279543 Length = 853 Score = 27.5 bits (58), Expect = 7.7 Identities = 21/95 (22%), Positives = 43/95 (45%), Gaps = 1/95 (1%) Frame = +3 Query: 216 AERQTDSSTRSSRMRVERLRKDTV-RIEEEKDSLLSTLDSIKHSELLLDISECDKDDITR 392 +E +T ++ ++ E+ V R+ EEK LLS L+S K E + S+ + + Sbjct: 415 SELETVKEEKNRALKKEQDATSRVQRLSEEKSKLLSDLESSKEEE---EKSKKAMESLAS 471 Query: 393 YADRILSRAMTVEVTVRTDRDHQQEEALYQVNMYI 497 + S ++ + + DH+ E + + + I Sbjct: 472 ALHEVSSEGRELKEKLLSQGDHEYETQIDDLKLVI 506 >At3g07530.1 68416.m00899 expressed protein ; expression supported by MPSS Length = 699 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 291 IEEEKDSLLSTLDSIKHSELLLDISEC 371 I + KDSLL+T DS++ E L + C Sbjct: 310 ISDNKDSLLNTEDSLEEMEKLAFVCSC 336 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,393,468 Number of Sequences: 28952 Number of extensions: 284807 Number of successful extensions: 783 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -