BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20104 (663 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 5.2 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 21 9.0 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 184 HLRSGRGCPDCWCPPGASQLP 246 HLR GRG + P ++ +P Sbjct: 192 HLRKGRGAIGAYGPEKSASIP 212 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +2 Query: 158 PVVMAGIIAIYGLVVAVLIAGALQEPANYPLY 253 P+V I+ G V ++AG L P P + Sbjct: 80 PIVKYIILIDLGEVAVTVLAGILTTPFKLPYF 111 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,741 Number of Sequences: 336 Number of extensions: 4108 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -