BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20103 (641 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|ch... 29 0.57 SPCC1235.12c |mug146||meiotically upregulated gene Mug46|Schizos... 27 2.3 SPBC12C2.09c |||Haemolysin-III family protein|Schizosaccharomyce... 25 9.3 SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyc... 25 9.3 >SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 546 Score = 29.1 bits (62), Expect = 0.57 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -2 Query: 160 AMFIVFFVDGNHHCDRFLQSSPSAIPLAVIIPHGA 56 ++ IVFFV N+ D + +PSA+ A ++ + A Sbjct: 457 SLLIVFFVSYNYIIDSYQHMAPSALAAATLVRYSA 491 >SPCC1235.12c |mug146||meiotically upregulated gene Mug46|Schizosaccharomyces pombe|chr 3|||Manual Length = 311 Score = 27.1 bits (57), Expect = 2.3 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 511 SEIY*KNAKFISLKPNSQSKSNSLMHKAAENINGIIYFNR 630 SE+ K F+S NS S N+ HK + ++ I + NR Sbjct: 45 SEVQCKLTHFLSSSENSSSVRNTRTHKFKQLLHYIFFSNR 84 >SPBC12C2.09c |||Haemolysin-III family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 324 Score = 25.0 bits (52), Expect = 9.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 187 FIHYCFIP*LYHIHNNFVNICTY 255 F Y + ++H+HN VNI T+ Sbjct: 73 FSFYLCVKSIFHVHNESVNIWTH 95 >SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1085 Score = 25.0 bits (52), Expect = 9.3 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 255 ICANVHKIIMDMIQSWNETIMNKPD 181 + AN+ KI+ + +Q NE++ K D Sbjct: 798 LIANIGKIVSNFLQEQNESLYTKAD 822 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,749,915 Number of Sequences: 5004 Number of extensions: 57363 Number of successful extensions: 117 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -