BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20103 (641 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0051 - 355392-355450,355507-355634,356271-356425,356883-35... 29 2.4 12_02_0058 + 13015401-13016654 27 9.6 >08_01_0051 - 355392-355450,355507-355634,356271-356425,356883-357012, 357600-357739,358384-358552,360286-360557 Length = 350 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = +2 Query: 2 PDRPYSMLQPGLSDAQANGSMGYNDRQRNRRR*TLEKTVTMVIPVDEEDDKHRNTPCTT* 181 P P + P +S + + G + + R ++T ++ IPVD + +NTP T Sbjct: 55 PRGPGTTWVPQVSGTKYQAARGVEEATAKQLRPRPDRTPSIAIPVDSDASPRKNTPETVT 114 Query: 182 SGL 190 S L Sbjct: 115 SPL 117 >12_02_0058 + 13015401-13016654 Length = 417 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -1 Query: 152 YXXXXXRESPL*PFSPKFTVGDSSGGHYTPWSHSP 48 Y +PL PF P +GGH+TP P Sbjct: 267 YPTDPFESAPLDPFEPPPAAASVTGGHHTPQPSVP 301 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,187,574 Number of Sequences: 37544 Number of extensions: 342327 Number of successful extensions: 734 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -