BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20103 (641 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) 29 2.4 SB_42556| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-06) 27 9.8 SB_56015| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 >SB_27310| Best HMM Match : CUB (HMM E-Value=9.7e-17) Length = 761 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/65 (24%), Positives = 26/65 (40%) Frame = +1 Query: 76 PPEESPTVNFGENGHNGDSXXXXXXXTSQHALHDLIWFIHYCFIP*LYHIHNNFVNICTY 255 PPE N G +H + + FI YCF+ +HI +N++ I Sbjct: 525 PPEYVILSNPGNQSQRSLGYSHGGNVGEKHQSYKQVLFIIYCFLQLYFHITSNYILIVNQ 584 Query: 256 DLKKD 270 +K+ Sbjct: 585 LARKN 589 >SB_42556| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-06) Length = 294 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 403 TWNRFTYFCGSRTLYTMILV 462 T +R YFCG+ +LY M L+ Sbjct: 94 TLHRLAYFCGAMSLYVMALM 113 >SB_56015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +2 Query: 503 LGNPKFIRKMQNLLA*SPTASLNQIVLCIRLRKTSME 613 L NPK IRK QN A S T S Q + RL S E Sbjct: 57 LANPKHIRKFQNTFANSKTHSQIQKHIRPRLPPISKE 93 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,022,271 Number of Sequences: 59808 Number of extensions: 398399 Number of successful extensions: 624 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 624 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -