BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20102 (471 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 33 0.074 At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase f... 31 0.52 At1g80840.1 68414.m09484 WRKY family transcription factor simila... 27 4.8 At1g59453.1 68414.m06679 transcription factor-related weak simil... 27 4.8 At1g59077.1 68414.m06670 hypothetical protein 27 4.8 At1g58766.1 68414.m06659 hypothetical protein 27 4.8 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 27 4.8 At5g64820.1 68418.m08155 hypothetical protein 27 6.4 At5g39510.1 68418.m04784 vesicle transport v-SNARE 11 (VTI11) / ... 27 6.4 At2g04620.1 68415.m00470 cation efflux family protein potential ... 27 6.4 At5g58860.1 68418.m07375 cytochrome P450 86A1 (CYP86) (CYP86A1) ... 27 8.5 At5g47690.1 68418.m05887 expressed protein 27 8.5 At5g43900.1 68418.m05368 myosin heavy chain (MYA2) nearly identi... 27 8.5 At4g28590.1 68417.m04089 expressed protein 27 8.5 At4g17080.1 68417.m02574 MORN (Membrane Occupation and Recogniti... 27 8.5 At3g30550.1 68416.m03866 hypothetical protein includes At2g05890... 27 8.5 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 33.5 bits (73), Expect = 0.074 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +3 Query: 6 LDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKK 185 +D + P+ +I+ + V +L S +P D+L++ L D DSA +K E K Sbjct: 154 VDLADLLPSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESKM 213 Query: 186 SEVITNV 206 + N+ Sbjct: 214 GSIAPNL 220 >At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase family protein contains Pfam profile PF01812 5-formyltetrahydrofolate cyclo-ligase Length = 354 Score = 30.7 bits (66), Expect = 0.52 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 276 PRTSSGIVSQLSSDLSSPKTRLSLCTSATVS 368 PR +G S L SDL P+T + CTS V+ Sbjct: 171 PRLRTGFFSVLESDLLKPETIMEACTSVGVA 201 >At1g80840.1 68414.m09484 WRKY family transcription factor similar to WRKY transcription factor GB:BAA87058 GI:6472585 from [Nicotiana tabacum] Length = 302 Score = 27.5 bits (58), Expect = 4.8 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -3 Query: 364 TVALVHKLNRVFGEDKSELNWETIPDDVLGALEPKLMAY 248 T ALV +LNRV E+K T+ D L +LM Y Sbjct: 30 TSALVEELNRVSAENKKLSEMLTLMCDNYNVLRKQLMEY 68 >At1g59453.1 68414.m06679 transcription factor-related weak similarity to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362 Length = 1729 Score = 27.5 bits (58), Expect = 4.8 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 99 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 206 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 1545 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 1581 >At1g59077.1 68414.m06670 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 4.8 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 99 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 206 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g58766.1 68414.m06659 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 4.8 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 99 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 206 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 27.5 bits (58), Expect = 4.8 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = +1 Query: 52 SWHLCMLQIPTSLTTFWRSSFTIASSSPITTV 147 +W + +L +P ++ FW + +ASS + + Sbjct: 1086 TWQVFLLVVPVAVACFWMQKYYMASSRELVRI 1117 >At5g64820.1 68418.m08155 hypothetical protein Length = 145 Score = 27.1 bits (57), Expect = 6.4 Identities = 16/68 (23%), Positives = 34/68 (50%) Frame = -3 Query: 439 CLVLAVAVGRSAIVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPDDVLGALEPK 260 C+++ + G SA A + A ++ E ++V ++ +FG +WE I + ++ K Sbjct: 15 CIIIILISGVSADGAESDSAAKKEENPSIVKIISGIFGNKFPPSSWELI-QGAMQKIQMK 73 Query: 259 LMAYSMQF 236 L ++ F Sbjct: 74 LYPPNLDF 81 >At5g39510.1 68418.m04784 vesicle transport v-SNARE 11 (VTI11) / vesicle soluble NSF attachment protein receptor VTI1a (VTI1A) identical to SP|Q9SEL6 Vesicle transport v-SNARE 11 (AtVTI11) (Vesicle transport v-SNARE protein VTI1a) (Vesicle soluble NSF attachment protein receptor VTI1a) (AtVTI1a) {Arabidopsis thaliana} Length = 221 Score = 27.1 bits (57), Expect = 6.4 Identities = 26/101 (25%), Positives = 47/101 (46%), Gaps = 3/101 (2%) Frame = +3 Query: 144 SAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAINFGSRAPRTSSGIVSQL---SS 314 SA+ ++K SE+ + + N + KM+ + + P S ++ +L S Sbjct: 25 SAISLDGEQKKQKLSEIKSGLENAEVLIRKMD-----LEARTLPPNLKSSLLVKLREFKS 79 Query: 315 DLSSPKTRLSLCTSATVSL*R*AMMFKATMADLPTATARTR 437 DL++ KT + TS ++ + +A MAD TA+A R Sbjct: 80 DLNNFKTEVKRITSGQLNAAARDELLEAGMADTKTASADQR 120 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.1 bits (57), Expect = 6.4 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -2 Query: 116 VKLLLQNVVRDVGICSIQRCH 54 +K ++N+++ G+CSIQR H Sbjct: 727 LKEAMRNILKTKGVCSIQRLH 747 >At5g58860.1 68418.m07375 cytochrome P450 86A1 (CYP86) (CYP86A1) / CYPLXXXVI / P450-dependent fatty acid omega-hydroxylase identical to Cytochrome P450 86A1 (CYPLXXXVI) (P450-dependent fatty acid omega-hydroxylase) (SP:P48422) [Arabidopsis thaliana] Length = 513 Score = 26.6 bits (56), Expect = 8.5 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +3 Query: 6 LDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLY-EEK 182 +DA K P+ +L F+ + +P D+L+ N V+ S+V S + Sbjct: 262 IDARKNSPSDDLLSRFLKKRDVNGNVLPTDVLQRIALNFVLAGRDTSSVALSWFFWLVMN 321 Query: 183 KSEVITNVVNKL 218 EV T +VN+L Sbjct: 322 NREVETKIVNEL 333 >At5g47690.1 68418.m05887 expressed protein Length = 1638 Score = 26.6 bits (56), Expect = 8.5 Identities = 11/44 (25%), Positives = 26/44 (59%) Frame = +3 Query: 93 DILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIR 224 D+LE++ Y V+ + + +YE ++SEV+ + +K+++ Sbjct: 734 DMLEDKRYQPAVLQCLGCIAQIAMPVYETRESEVVEFIRSKILK 777 >At5g43900.1 68418.m05368 myosin heavy chain (MYA2) nearly identical to PIR|S51824 myosin heavy chain MYA2 [Arabidopsis thaliana] Length = 1505 Score = 26.6 bits (56), Expect = 8.5 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Frame = -3 Query: 409 SAIVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPDDVLGALEPKLMAYSMQFIL 230 S +++L I A R S+ L + R FG+D ++W++I D L +L L + +L Sbjct: 1269 STLLSLCIQAPRSSKGGML--RSGRSFGKDSPAVHWQSIIDG-LNSLLVTLKENHVPLVL 1325 Query: 229 LFRI-SLFTTFVMTSLFFS 176 + +I S +++ LF S Sbjct: 1326 IQKIYSQTFSYINVQLFNS 1344 >At4g28590.1 68417.m04089 expressed protein Length = 331 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 349 HKLNRVFGEDKSELNWETIPDD 284 H + V G+D SE++WE DD Sbjct: 180 HPIKNVVGDDGSEIDWEGEIDD 201 >At4g17080.1 68417.m02574 MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein /phosphatidylinositol-4-phosphate 5-kinase-related low similarity to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profile PF02493: MORN repeat Length = 471 Score = 26.6 bits (56), Expect = 8.5 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 55 WHLCMLQIPTSLTTFWRSSFTIASSSPITTVRLKRASIYTRRRRAK 192 W +L PT TT SSF+I+ S + TV+ R + R K Sbjct: 385 WEDGVLNCPTEQTTRPDSSFSISHSKVVDTVQQARKAAKKAREVVK 430 >At3g30550.1 68416.m03866 hypothetical protein includes At2g05890, At4g07450, At3g30630, At3g43100, At2g09960, At3g30550, At1g39430, At2g10460, At4g03640, At5g35250 Length = 509 Score = 26.6 bits (56), Expect = 8.5 Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +3 Query: 39 ILCLFVASLYAA-DSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVN 212 +LC+ +++ DS + + + + +V DYD+ V+ S + E+ S ++TN V+ Sbjct: 405 LLCVQRENIFGGYDSFTVARVYTDNIADEIVQEDYDAYVDPSSLISIEQDSLMLTNGVD 463 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,899,998 Number of Sequences: 28952 Number of extensions: 161567 Number of successful extensions: 724 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -