BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20098 (563 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY360172-1|AAQ98857.1| 693|Homo sapiens transducer of regulated... 30 6.5 >AY360172-1|AAQ98857.1| 693|Homo sapiens transducer of regulated CREB protein 2 protein. Length = 693 Score = 29.9 bits (64), Expect = 6.5 Identities = 25/83 (30%), Positives = 36/83 (43%) Frame = +3 Query: 306 CELLRCSKLN*SPLRLLLERQRGASSSSCTPVISLTSWPFSEPTDLVASTH*TKCRLSSA 485 C +L + L L +SSS+ +PV+ S+P S P AS H + LS Sbjct: 379 CHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPASTPG---ASPHHRRVPLSPL 435 Query: 486 LLLXTGNTLHVRRSPPHLPRKLA 554 LL RRS LP++ + Sbjct: 436 SLL--AGPADARRSQQQLPKQFS 456 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,364,232 Number of Sequences: 237096 Number of extensions: 1434955 Number of successful extensions: 3958 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3958 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5703349406 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -