BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20097 (372 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 1.8 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 2.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 2.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 2.3 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 21 3.1 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 21 5.4 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 1.8 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +1 Query: 184 SLRSPTESKARFHAGCVPKQSIYMTGILYVPTRRNIQMPKNRKQ 315 S +SP ARF++ + Y L P + PK+ K+ Sbjct: 79 SYQSPQTQPARFYSTPIVPHFAYNHNPLTPPNSEPLVSPKSEKE 122 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.8 bits (44), Expect = 2.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 255 DWNSVRADKKKHSDAEEQETISHYLNRNK 341 D ++ + DKKK +E+ T LN+ K Sbjct: 255 DEDTKKEDKKKKKTIKEKYTEDEELNKTK 283 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 2.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 321 HYLNRNKEYLETYILE 368 HYLNRN+E ++E Sbjct: 1186 HYLNRNEETFWNELIE 1201 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 2.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 321 HYLNRNKEYLETYILE 368 HYLNRN+E ++E Sbjct: 1186 HYLNRNEETFWNELIE 1201 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 21.4 bits (43), Expect = 3.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 235 PKQSIYMTGILYVPTRRNIQ 294 P+QSI ++G + PT+ IQ Sbjct: 26 PQQSIIVSGSITQPTKTVIQ 45 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 20.6 bits (41), Expect = 5.4 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 221 WNRALLSVGDLNEAGVPE 168 WN SVG NE +P+ Sbjct: 17 WNEGPNSVGVSNEVSLPQ 34 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,257 Number of Sequences: 336 Number of extensions: 1921 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7722305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -