BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20094 (527 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19A8.15 |trp2||tryptophan synthase|Schizosaccharomyces pombe... 27 2.3 SPAC2F7.09c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 7.0 SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pomb... 25 9.2 SPAC31G5.17c |rps1001|rps10-1|40S ribosomal protein S10|Schizosa... 25 9.2 >SPAC19A8.15 |trp2||tryptophan synthase|Schizosaccharomyces pombe|chr 1|||Manual Length = 697 Score = 26.6 bits (56), Expect = 2.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 369 PMICKRSKMSLRNKVTLYKTCIRPVHDLRECGV 467 P ICK ++++L+N +TL K V R+ GV Sbjct: 63 PTICKGNEIALKNNITLEKV-FETVKLARDAGV 94 >SPAC2F7.09c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 491 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 279 LGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKR 386 LG++ +M + H ++ D+ +LGR+ P++C R Sbjct: 177 LGISSKYAMLYTSHSFNLVDK---LLGRINPLLCSR 209 >SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1095 Score = 24.6 bits (51), Expect = 9.2 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 114 VVPKMAHRHQPSEKYCGAISEGKLHTDFLPD 206 V+P +A H P ++ + G++ TDF PD Sbjct: 417 VLPLLADPH-PRVRWAACNAVGQMSTDFAPD 446 >SPAC31G5.17c |rps1001|rps10-1|40S ribosomal protein S10|Schizosaccharomyces pombe|chr 1|||Manual Length = 144 Score = 24.6 bits (51), Expect = 9.2 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 176 GEAPHGFPPGLGGGISHPR 232 G AP GF P GG P+ Sbjct: 126 GAAPSGFAPSFRGGFGRPQ 144 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,203,248 Number of Sequences: 5004 Number of extensions: 43542 Number of successful extensions: 98 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 216376042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -